Dbfetch

ID   AK168839; SV 1; linear; mRNA; HTC; MUS; 1998 BP.
XX
AC   AK168839;
XX
DT   09-SEP-2005 (Rel. 85, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 10)
XX
DE   Mus musculus 17 days embryo kidney cDNA, RIKEN full-length enriched
DE   library, clone:I920059J21 product:11 beta-hydroxylase homolog [Mus sp],
DE   full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1998
RA   Arakawa T., Carninci P., Fukuda S., Hashizume W., Hayashida K., Hori F.,
RA   Iida J., Imamura K., Imotani K., Itoh M., Kanagawa S., Kawai J., Kojima M.,
RA   Konno H., Murata M., Nakamura M., Ninomiya N., Nishiyori H., Nomura K.,
RA   Ohno M., Sakazume N., Sano H., Sasaki D., Shibata K., Shiraki T.,
RA   Tagami M., Tagami Y., Waki K., Watahiki A., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (14-APR-2004) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science, e1252229 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science, e1252229 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; d3c31c06a09e9ef35688f36de77a3354.
DR   Ensembl-Gn; ENSMUSG00000075604; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0021942; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AKRJ_G0021883; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0021908; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0021681; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0022348; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0021200; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0021647; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0021772; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0021754; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0022369; mus_musculus_nzohlltj.
DR   Ensembl-Tr; ENSMUST00000170259; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0041229; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AKRJ_T0041156; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0041182; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0040920; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0041654; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0040990; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0040825; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0040979; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0040953; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0041696; mus_musculus_nzohlltj.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=I920059J21
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1998
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /dev_stage="17 days embryo"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="I920059J21"
FT                   /tissue_type="kidney"
FT                   /db_xref="taxon:10090"
FT   CDS             9..1514
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="11 beta-hydroxylase homolog [Mus sp]
FT                   (UniProt|Q9QW69, evidence: FASTY, 97.6%ID, 100%length,
FT                   match=1497)"
FT                   /note="putative"
FT                   /db_xref="GOA:Q3TG86"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002399"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="MGI:MGI:88583"
FT                   /db_xref="UniProtKB/TrEMBL:Q3TG86"
FT                   /protein_id="BAE40662.1"
FT                   /translation="MTMALRVTTDVWLARPWQCLHRTRALGTTATLAPKTLQPFEAIPQ
FT                   YSRNKWLKMIQILREQGQENLHLEMHQVFRELGPIFRHSVGKTQIVFVTLPEDVEKLYQ
FT                   VESTHPCRMPLESWIVHRELRGLGRGVFLLNGPEWYFNRLQLNPNVLSPKAVQKFVPLV
FT                   DGIARDFVDNLKKKMLESVHGSFSMDFQSSVFNYTIEASHFVLFGERLGLIGRDLSPDS
FT                   LKFLHTLHSMFKTTTQLLYLPRSLTRWTSTRVWKENLESWDFISEYVTKCIKNVYRELA
FT                   EGRPQSWSVTAELVAERTLSMDAIQANSMELIAGSTDTTSTPLVMTFFELARNPDVQQA
FT                   LRQESLAAEASIAANPQKAMSDLPLLRAALKETLRLYPVGTFLERILSSDLVLQNYHVP
FT                   AGTVLNVNLYSMGRNPAVFPRPERYMPQRWLERKRSFKHLAFGFGVRQCLGRRLAEAEM
FT                   MLLLHHVLKSFHVETQEKEDVRMAYRFVLMPSSSPLLTFRPVN"
XX
SQ   Sequence 1998 BP; 476 A; 521 C; 512 G; 489 T; 0 other;
     ggaggaagat gacaatggct ctcagggtga caacagatgt gtggctggca agaccctggc        60
     agtgcctgca caggacaagg gcactgggca ccacggcaac actggcccca aagaccctgc       120
     agccctttga agccatacca cagtactcca ggaacaagtg gctgaagatg atacagatcc       180
     tgagggagca gggccaagaa aacctacacc tggagatgca tcaggtcttc cgggagctgg       240
     ggcccatttt caggcacagt gtagggaaaa cacagattgt gtttgtgacg ttgccggagg       300
     atgttgagaa gctgtaccag gtagagagta cgcacccttg ccgcatgccc ttggaatcct       360
     ggatagtcca tagagaactc cgtggcctgg gacgtggtgt gttcttgcta aatgggccag       420
     aatggtactt caaccgactg cagctgaacc caaatgttct gtcaccaaaa gccgttcaaa       480
     aatttgtccc cttggtggat gggatagcaa gggactttgt ggataacctg aagaagaaaa       540
     tgctggaaag tgtccatggt agcttctcta tggactttca gtccagtgtg ttcaactata       600
     ccatagaagc tagccacttt gttctttttg gggagcggct gggcctcatt ggccgtgatc       660
     tgagccctga cagcctgaag ttcctccaca ccctgcactc catgttcaaa accaccacac       720
     agctcttgta cttgcccagg agcctgaccc gatggacaag caccagggtg tggaaagaaa       780
     acttagagtc ctgggatttc atctctgaat atgtcaccaa atgtatcaag aatgtgtatc       840
     gagagctggc agagggtcgt ccacagtcct ggagtgtcac agcagagctg gtagctgaga       900
     gaactctgtc aatggatgcc atccaggcta actcaatgga actcattgct ggaagcactg       960
     acacgacatc aacccccttg gtaatgactt tctttgagct ggctcggaac ccagatgttc      1020
     agcaggccct gaggcaggag agcctggcag ctgaggccag catcgctgca aatcctcaga      1080
     aggccatgtc agacctgccc ttgctgaggg ctgcccttaa agagaccttg aggctctatc      1140
     ctgttggtac ttttctggag agaattctaa gctcagactt ggtgcttcag aactaccatg      1200
     tccctgctgg gacagtcctc aatgtgaatc tgtattccat gggccggaac cctgcagtgt      1260
     tcccaaggcc tgaacgctat atgcctcagc gctggctgga gaggaaaagg agtttcaagc      1320
     acctggcctt tggctttggg gtgcgccagt gcctggggag gcgcctggca gaggcagaga      1380
     tgatgctcct gcttcaccat gtgctgaaat ccttccacgt ggagacacaa gagaaagagg      1440
     atgtgcggat ggcctaccgc ttcgttttga tgcccagctc cagtcctctc ctcactttca      1500
     ggcctgtcaa ctagtcacac agcctttttc ttttggtgtc ccaagatgtc aatagcttcc      1560
     tgttctgatg acacattgcc ctctcttctc ttccttagag tgctatgcct gtggccatgc      1620
     tcagcctctt gtctagtatc tgacagattg tgattcgggg tcagagaatg gctctggaga      1680
     attgctgtcc cctaactgtc acctcccagt ctcctcccgt ggtcatccaa gtgagcccat      1740
     cttctgactt tctgtctggt tcccatcatc cttgtcacac tctttctgtc ccttctaaaa      1800
     tatcttgttt gaatgttgta caaggggaac ccaccatcag taaggacatc tcatgtcagc      1860
     agtgaaagcc tatgaccact catgacacat tgtcatgcgt gagggaagac agaactaatg      1920
     tgtatgttgc acacctcaga tgccatgtgg tccagcttag acctcacaca cacagtaaat      1980
     gctcagtgat cattctcc                                                    1998
//