Dbfetch

ID   AK168818; SV 1; linear; mRNA; HTC; MUS; 1886 BP.
XX
AC   AK168818;
XX
DT   09-SEP-2005 (Rel. 85, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 10)
XX
DE   Mus musculus 17 days pregnant adult female amnion cDNA, RIKEN full-length
DE   enriched library, clone:I920057I16 product:alpha fetoprotein, full insert
DE   sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1886
RA   Arakawa T., Carninci P., Fukuda S., Hashizume W., Hayashida K., Hori F.,
RA   Iida J., Imamura K., Imotani K., Itoh M., Kanagawa S., Kawai J., Kojima M.,
RA   Konno H., Murata M., Nakamura M., Ninomiya N., Nishiyori H., Nomura K.,
RA   Ohno M., Sakazume N., Sano H., Sasaki D., Shibata K., Shiraki T.,
RA   Tagami M., Tagami Y., Waki K., Watahiki A., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (14-APR-2004) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science, e1252229 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science, e1252229 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; 72317c9f0f1dcdf68ae54af93663f228.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=I920057I16
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1886
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /sex="female"
FT                   /dev_stage="17 days pregnant adult"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="I920057I16"
FT                   /tissue_type="amnion"
FT                   /db_xref="taxon:10090"
FT   CDS             <1..1739
FT                   /codon_start=3
FT                   /transl_table=1
FT                   /note="alpha fetoprotein (MGD|MGI:87951 GB|NM_007423,
FT                   evidence: BLASTN, 99%, match=1886)"
FT                   /note="putative"
FT                   /note="start codon is not identified"
FT                   /db_xref="GOA:Q3TGA3"
FT                   /db_xref="InterPro:IPR000264"
FT                   /db_xref="InterPro:IPR014760"
FT                   /db_xref="InterPro:IPR020857"
FT                   /db_xref="InterPro:IPR020858"
FT                   /db_xref="InterPro:IPR021177"
FT                   /db_xref="MGI:MGI:87951"
FT                   /db_xref="UniProtKB/TrEMBL:Q3TGA3"
FT                   /protein_id="BAE40645.1"
FT                   /translation="IASTLDSSQCVTEKNVLSIATITFTQFVPEATEEEVNKMTSDVLA
FT                   AMKKNSGDGCLESQLSVFLDEICHETELSNKYGLSGCCSQSGVERHQCLLARKKTAPAS
FT                   VPPFQFPEPAESCKAHEENRAVFMNRFIYEVSRRNPFMYAPAILSLAAQYDKVVLACCK
FT                   ADNKEECFQTKRASIAKELREGSMLNEHVCSVIRKFGSRNLQATTIIKLSQKLTEANFT
FT                   EIQKLALDVAHIHEECCQGNSLECLQDGEKVMTYICSQQNILSSKIAECCKLPMIQLGF
FT                   CIIHAENGVKPEGLSLNPSQFLGDRNFAQFSSEEKIMFMASFLHEYSRTHPNLPVSVIL
FT                   RIAKTYQEILEKCSQSGNLPGCQDNLEEELQKHIEESQALSKQSCALYQTLGDYKLQNL
FT                   FLIGYTRKAPQLTSAELIDLTGKMVSIASTCCQLSEEKWSGCGEGMADIFIGHLCIRNE
FT                   ASPVNSGISHCCNSSYSNRRLCITSFLRDETYAPPPFSEDKFIFHKDLCQAQGKALQTM
FT                   KQELLINLVKQKPELTEEQLAAVTADFSGLLEKCCKAQDQEVCFTEEGPKLISKTRDAL
FT                   GV"
FT   regulatory      1869..1874
FT                   /note="putative"
FT                   /regulatory_class="polyA_signal_sequence"
FT   polyA_site      1886
FT                   /note="putative"
XX
SQ   Sequence 1886 BP; 559 A; 425 C; 448 G; 454 T; 0 other;
     ggatagcttc cacgttagat tcctcccagt gcgtgacgga gaagaatgtg cttagcatag        60
     ctaccatcac ctttacccag tttgttccgg aagccaccga ggaggaagtg aacaaaatga       120
     ctagcgatgt gttggctgca atgaagaaaa actctggcga tgggtgttta gaaagccagc       180
     tatctgtgtt tctggatgaa atttgtcatg agacggaact ctctaacaag tatggactct       240
     caggctgctg cagccaaagt ggagtggaaa gacatcagtg tctgctggca cgcaagaaga       300
     ctgctccggc ctctgtccca cccttccagt ttccagaacc tgccgagagt tgcaaagcac       360
     atgaagaaaa cagggcagtg ttcatgaaca ggttcatcta tgaagtgtca aggaggaacc       420
     ccttcatgta tgccccagcc attctgtcct tggctgctca gtacgacaag gtcgttctgg       480
     catgctgcaa agctgacaac aaggaggagt gcttccagac aaagagagca tccattgcaa       540
     aggaattaag agaaggaagc atgttaaatg agcatgtatg ttcagtgata agaaaatttg       600
     gatcccgaaa cctccaggca acaaccatta ttaagctaag tcaaaagtta actgaagcaa       660
     attttactga gattcagaag ctggccctgg atgtggctca catccacgag gagtgttgcc       720
     aaggaaactc gctggagtgt ctgcaggatg gggaaaaagt catgacatat atatgttctc       780
     aacaaaatat tctgtcaagc aaaatagcag agtgctgcaa attacccatg atccaactag       840
     gcttctgcat aattcacgca gagaatggcg tcaaacctga aggcttatct ctaaatccaa       900
     gccagttttt gggagacaga aattttgccc aattttcttc agaggaaaaa atcatgttca       960
     tggcaagctt tcttcatgaa tactcaagaa ctcaccccaa ccttcctgtc tcagtcattc      1020
     taagaattgc taaaacgtac caggaaatat tggagaagtg ttcccagtct ggaaatctac      1080
     ctggatgtca ggacaatctg gaagaagaat tgcagaaaca catcgaggag agccaggcac      1140
     tgtccaagca aagctgcgct ctctaccaga ccttaggaga ctacaaatta caaaatctgt      1200
     tccttattgg ttacacgagg aaagcccctc agctgacctc agcagagctg atcgacctca      1260
     ccgggaagat ggtgagcatt gcctccacgt gctgccagct cagcgaggag aaatggtccg      1320
     gctgtggtga gggaatggcc gacattttca ttggacattt gtgtataagg aatgaagcaa      1380
     gccctgtgaa ctctggtatc agccactgct gcaactcttc gtattccaac aggaggctat      1440
     gcatcaccag ttttctgagg gatgaaacct atgcccctcc cccattctct gaggataaat      1500
     tcatcttcca caaggatctg tgccaagctc agggcaaagc cctacagacc atgaaacaag      1560
     agcttctcat taacctggtg aagcaaaagc ctgaactgac agaggagcag ctggcggctg      1620
     tcactgcaga tttctcgggc cttttggaga agtgctgcaa agcccaggac caggaagtct      1680
     gtttcacaga agagggtcca aagttgattt ccaaaactcg tgatgctttg ggcgtttaaa      1740
     catctccaga aggaagagtg gacaaaaaaa tgtgttgact ctttggtgtg agccttttgg      1800
     cttaactgta actgctagta ctttaaccac atggtgaaga tgtccatgtg agatttctat      1860
     accttaggaa taaaaacttt tcaact                                           1886
//