spacer

EBI Dbfetch

ID   AK168739; SV 1; linear; mRNA; HTC; MUS; 1522 BP.
XX
AC   AK168739;
XX
DT   09-SEP-2005 (Rel. 85, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 10)
XX
DE   Mus musculus 13 days embryo liver cDNA, RIKEN full-length enriched library,
DE   clone:I920049G14 product:argininosuccinate lyase, full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1522
RA   Arakawa T., Carninci P., Fukuda S., Hashizume W., Hayashida K., Hori F.,
RA   Iida J., Imamura K., Imotani K., Itoh M., Kanagawa S., Kawai J., Kojima M.,
RA   Konno H., Murata M., Nakamura M., Ninomiya N., Nishiyori H., Nomura K.,
RA   Ohno M., Sakazume N., Sano H., Sasaki D., Shibata K., Shiraki T.,
RA   Tagami M., Tagami Y., Waki K., Watahiki A., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (14-APR-2004) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; 82af031c5b37c3b08d0500e8d7b30d5e.
DR   Ensembl-Gn; ENSMUSG00000025533; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000159619; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000160129; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000161094; mus_musculus.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=I920049G14
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1522
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /dev_stage="13 days embryo"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="I920049G14"
FT                   /tissue_type="liver"
FT                   /db_xref="taxon:10090"
FT   CDS             77..1471
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="argininosuccinate lyase (MGD|MGI:88084 GB|NM_133768,
FT                   evidence: BLASTN, 100%, match=1519)"
FT                   /note="putative"
FT                   /db_xref="GOA:Q91YI0"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR009049"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="InterPro:IPR029419"
FT                   /db_xref="MGI:MGI:88084"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q91YI0"
FT                   /protein_id="BAE40580.1"
FT                   /translation="MASESGKLWGGRFVGAVDPIMEKFNSSISYDRHLWNVDVQGSKAY
FT                   SRGLEKAGLLTKAEMQQILQGLDKVAEEWAQGTFKLHPNDEDIHTANERRLKELIGEAA
FT                   GKLHTGRSRNDQVVTDLRLWMRQTCSKLSALLRVLIGTMVDRAEAERDVLFPGYTHLQR
FT                   AQPIRWSHWILSHAVALTRDSERLLEVQKRINVLPLGSGAIAGNPLGVDRELLRAELNF
FT                   GAITLNSMDATSERDFVAEFLFWASLCMTHLSRMAEDLILYGTKEFSFVQLSDAYSTGS
FT                   SLMPQKKNPDSLELIRSKAGRVFGRCAGLLMTLKGLPSTYNKDLQEDKEAVFEVSDTMI
FT                   AVLQVATGVISTLQIHRENMKQALSPDMLATDLAYYLVRKGMPFRQAHEASGKAVFMAE
FT                   TKGVALNLLSLQELQTISPLFSGDVSHVWDYSHSVEQYSALGGTAKSSVEWQIRQVRAL
FT                   LQAQEP"
FT   polyA_signal    1498..1503
FT                   /note="putative"
FT   polyA_site      1522
FT                   /note="putative"
XX
SQ   Sequence 1522 BP; 381 A; 408 C; 450 G; 283 T; 0 other;
     ttgggaccag aaaaagccag gagagaccag aagattcgta agacagaagc tccaggagga        60
     ggaggaaccg cccaacatgg catcagagag cgggaagcta tggggtggcc ggtttgtggg       120
     tgctgtcgac cccatcatgg agaagttcaa ctcatctatc tcctatgacc ggcatctgtg       180
     gaatgtggat gtgcagggga gcaaggccta cagcaggggc ctggagaagg cggggcttct       240
     caccaaagcc gagatgcagc agatactgca agggttggac aaggttgctg aagagtgggc       300
     ccaaggcacc ttcaaattac atcctaatga tgaagacatc cacacagcca acgagcggcg       360
     cctgaaggaa ctcatcggtg aagctgcagg gaagctacac acaggacgaa gtcgcaacga       420
     ccaggtggtc acggacctca ggctgtggat gaggcagacc tgctcaaaac tctccgccct       480
     cctccgggtg ctcattggaa ccatggtcga ccgggcagag gcggaacgtg atgtcctctt       540
     cccagggtac acacacttgc agagagctca gcccattcgc tggagccact ggatcctgag       600
     ccacgctgtt gcgctgacac gagattcaga gagactcttg gaggtgcaga agcggatcaa       660
     tgtcttgcca ctggggagtg gggccattgc aggcaaccct ctgggtgtgg accgggagct       720
     actccgtgca gaactgaact ttggggccat cactctcaac agcatggatg ccaccagtga       780
     gagagacttt gtggctgagt tcctgttttg ggcttctctg tgtatgaccc acctcagcag       840
     gatggcagag gacctaattc tctatggtac caaggaattc agctttgtgc aactctcaga       900
     tgcctacagc accggaagca gcttgatgcc ccagaagaaa aacccagaca gcctggagct       960
     gatccggagc aaggcgggcc gagtgtttgg acggtgtgcc ggactcctga tgaccctcaa      1020
     gggacttcca agcacctaca acaaggactt acaggaagac aaggaggctg tgtttgaagt      1080
     gtctgacacc atgatagctg tcctccaagt ggccactgga gtcatctcta cattgcagat      1140
     tcatcgtgag aacatgaaac aggcgctcag ccctgacatg ctggccacgg acctcgccta      1200
     ctacctggtc cgcaaaggga tgccattccg ccaggcccac gaggcctcag ggaaagctgt      1260
     gttcatggca gagactaaag gagtggctct caacctgctg tcgctacagg agctgcagac      1320
     catcagtccc ctgttctcag gtgatgtgag tcacgtgtgg gactacagtc acagcgtgga      1380
     acagtacagt gccttgggtg gcacagcgaa atccagtgtc gaatggcaga tcaggcaggt      1440
     gcgggcccta ctgcaagccc aggagcccta gatcccgccc acccaaagct gctccccaat      1500
     aaagtggagc cctgaagaaa cc                                               1522
//


spacer
spacer