spacer

EBI Dbfetch

ID   AK168656; SV 1; linear; mRNA; HTC; MUS; 992 BP.
XX
AC   AK168656;
XX
DT   09-SEP-2005 (Rel. 85, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 10)
XX
DE   Mus musculus 17 days embryo heart cDNA, RIKEN full-length enriched library,
DE   clone:I920041N05 product:prohibitin, full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-992
RA   Arakawa T., Carninci P., Fukuda S., Hashizume W., Hayashida K., Hori F.,
RA   Iida J., Imamura K., Imotani K., Itoh M., Kanagawa S., Kawai J., Kojima M.,
RA   Konno H., Murata M., Nakamura M., Ninomiya N., Nishiyori H., Nomura K.,
RA   Ohno M., Sakazume N., Sano H., Sasaki D., Shibata K., Shiraki T.,
RA   Tagami M., Tagami Y., Waki K., Watahiki A., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (14-APR-2004) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; 512829696edcaef5e8ac39780748949d.
DR   Ensembl-Gn; ENSMUSG00000038845; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000125172; mus_musculus.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=I920041N05
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..992
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /dev_stage="17 days embryo"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="I920041N05"
FT                   /tissue_type="heart"
FT                   /db_xref="taxon:10090"
FT   CDS             53..871
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="prohibitin (MGD|MGI:97572 GB|NM_008831, evidence:
FT                   BLASTN, 100%, match=991)"
FT                   /note="putative"
FT                   /db_xref="GOA:P67778"
FT                   /db_xref="InterPro:IPR000163"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="MGI:MGI:97572"
FT                   /db_xref="UniProtKB/Swiss-Prot:P67778"
FT                   /protein_id="BAE40512.1"
FT                   /translation="MAAKVFESIGKFGLALAVAGGVVNSALYNVDAGHRAVIFDRFRGV
FT                   QDIVVGEGTHFLIPWVQKPIIFDCRSRPRNVPVITGSKDLQNVNITLRILFRPVASQLP
FT                   RIYTSIGEDYDERVLPSITTEILKSVVARFDAGELITQRELVSRQVSDDLTERAATFGL
FT                   ILDDVSLTHLTFGKEFTEAVEAKQVAQQEAERARFVVEKAEQQKKAAIISAEGDSKAAE
FT                   LIANSLATAGDGLIELRKLEAAEDIAYQLSRSRNITYLPAGQSVLLQLPQ"
FT   polyA_signal    973..978
FT                   /note="putative"
FT   polyA_site      992
FT                   /note="putative"
XX
SQ   Sequence 992 BP; 235 A; 260 C; 288 G; 209 T; 0 other;
     gatgtggagg tcagagtgaa agcaggtgtg agtggaagca acagaaggag tcatggctgc        60
     caaagtgttt gagtccattg gaaagttcgg cctggcgttg gcagttgcag gaggcgtggt       120
     gaactctgct ttgtataatg tggatgctgg acacagagct gtcatctttg accgattccg       180
     tggcgtacag gacattgtgg tcggggaagg gactcatttc ctcatccctt gggtacagaa       240
     accaattatc tttgactgcc gctctcgacc acggaacgta ccagtcatca ctggtagcaa       300
     agacttgcag aacgtcaata tcacactgcg aatcctcttc cggccggtgg ccagccagct       360
     tcctcgtatc tacaccagca ttggcgagga ctatgatgag cgggtcctgc cttctatcac       420
     cacagagatc ctcaagtcgg tggtggctcg attcgatgct ggagaattga ttacccagcg       480
     agagctggtc tccaggcagg tgagcgatga cctcacagag cgagcggcaa catttgggct       540
     tatcctggat gacgtgtccc tgacacatct gaccttcggg aaggagttca cagaggcagt       600
     agaagccaaa caggtggctc agcaggaagc ggagagagcc agatttgtgg tggaaaaggc       660
     tgagcagcag aagaaggcag ccatcatctc tgctgagggt gactccaagg ccgctgagct       720
     gatcgccaac tcgctggcca cggcaggcga cggcctgatc gagctgcgga agctggaggc       780
     cgccgaggac attgcgtacc agctctcccg ctctcggaac atcacctacc tgccagcggg       840
     ccagtccgtg cttctccagc ttccccagtg aggccagccg ggccacggcc tccatcatgc       900
     tgaatgacgc cttccttctg ccccacccca gaaaatcact gtgaaatttc atgattggct       960
     taaagtgaag gaaataaagg taaaatcact tc                                     992
//


spacer
spacer