spacer

EBI Dbfetch

ID   AK168633; SV 1; linear; mRNA; HTC; MUS; 3999 BP.
XX
AC   AK168633;
XX
DT   09-SEP-2005 (Rel. 85, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 10)
XX
DE   Mus musculus 17 days pregnant adult female amnion cDNA, RIKEN full-length
DE   enriched library, clone:I920040F12 product:twisted gastrulation homolog 1
DE   (Drosophila), full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-3999
RA   Arakawa T., Carninci P., Fukuda S., Hashizume W., Hayashida K., Hori F.,
RA   Iida J., Imamura K., Imotani K., Itoh M., Kanagawa S., Kawai J., Kojima M.,
RA   Konno H., Murata M., Nakamura M., Ninomiya N., Nishiyori H., Nomura K.,
RA   Ohno M., Sakazume N., Sano H., Sasaki D., Shibata K., Shiraki T.,
RA   Tagami M., Tagami Y., Waki K., Watahiki A., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (14-APR-2004) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; 216d984a9d960b1e24438bfdf1e45f6c.
DR   Ensembl-Gn; ENSMUSG00000024098; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000024906; mus_musculus.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=I920040F12
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3999
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /sex="female"
FT                   /dev_stage="17 days pregnant adult"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="I920040F12"
FT                   /tissue_type="amnion"
FT                   /db_xref="taxon:10090"
FT   CDS             118..786
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="putative"
FT                   /note="twisted gastrulation homolog 1 (Drosophila)
FT                   (MGD|MGI:2137520 GB|AK049646, evidence: BLASTN, 99%,
FT                   match=3991)"
FT                   /db_xref="GOA:Q9EP52"
FT                   /db_xref="InterPro:IPR006761"
FT                   /db_xref="MGI:MGI:2137520"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9EP52"
FT                   /protein_id="BAE40493.1"
FT                   /translation="MKSHYIVLALASLTFLLCLPVSQSCNKALCASDVSKCLIQELCQC
FT                   RPGEGNCPCCKECMLCLGALWDECCDCVGMCNPRNYSDTPPTSKSTVEELHEPIPSLFR
FT                   ALTEGDTQLNWNIVSFPVAEELSHHENLVSFLETVNQLHHQNVSVPSNNVHAPFPSDKE
FT                   RMCTVVYFDDCMSIHQCKISCESMGASKYRWFHNACCECIGPECIDYGSKTVKCMNCMF
FT                   "
FT   polyA_signal    3983..3988
FT                   /note="putative"
FT   polyA_site      3999
FT                   /note="putative"
XX
SQ   Sequence 3999 BP; 1060 A; 875 C; 909 G; 1155 T; 0 other;
     ggcgggcctg tgtgtccgcg gcgccggggt tcgcgggagc tgcttggagg ctcggcggcc        60
     gggaggaggc cggggccacg cttcttggaa gctactgagt gacttctttg aagaaccatg       120
     aagtcacact atattgtgct agctctagcc tccctgacgt tcctgctgtg tctccccgtg       180
     tcccagagct gtaacaaagc actctgtgcc agcgatgtga gcaaatgcct cattcaggag       240
     ctctgccagt gccggcctgg agaagggaac tgcccctgct gtaaggagtg catgctgtgc       300
     ctcggggccc tgtgggacga gtgctgcgac tgtgtcggta tgtgcaaccc tcggaattac       360
     agcgacaccc cgcccacatc caagagcacc gtggaggagc tgcacgagcc cattccgtcc       420
     ctgttcaggg cgctgacgga gggcgacacc cagctgaact ggaacatcgt ctccttccct       480
     gtggcagagg agctgtcaca ccatgaaaac ctagtctcct tcctagaaac tgtgaaccag       540
     ctgcaccacc aaaacgtgtc tgttcccagc aacaatgtcc acgccccctt ccccagcgac       600
     aaagagcgca tgtgcacagt ggtttacttt gatgactgca tgtccatcca ccaatgtaag       660
     atatcctgcg aatccatggg tgcatccaag tatcgctggt ttcacaacgc ctgctgcgag       720
     tgcatcggtc cagagtgcat tgactatggg agtaaaactg tcaagtgtat gaactgcatg       780
     ttttaaagag ggggaagaaa tgcaaaccaa agcagtaagt catgaagtgt gcagaaatct       840
     tggttctggt atgctaggag tgtgttaagt tatatgattg taactgtgct ttttatatct       900
     ggtgcctatt agtgtaggtc ttttccattg gattcaatgg aactttagtc acatgaggat       960
     cgggagttca gaggagtcct gggaaaacct gacatgctga cagaaggtgc cgtcttcttc      1020
     cagctttcca aacacttctc gttttgaacg tgatagcaca agcctggtac atgtgtggtt      1080
     ctcacctgcc agttgtagaa cactaggtcc ctatagtcac acatctctta attgtgcctt      1140
     ggctggctta cctgttttgt atgagtaaat attacagttt ataattctaa caactcacat      1200
     tcaagccatg ctgaaactta atttcaaacc actttacatt ggttttagaa agtaaatatt      1260
     tactatattt tacaacagaa gagttttgcc tagggccagc gagctgactc agtggataaa      1320
     ggcgcttgct accaagcctg ataacctgag ttccatcccc agagcccgta cagtggaagg      1380
     acaggaccag ctgctgggag ttgtcctctg acctccagac aggcacagta tcatgcgtgg      1440
     aggtgtgctt gtgtgtgcac acacataact aactgttttt aaaaatataa acctcttaca      1500
     tggtgaaatc taaatctgtc gtgtagctct cacactgaca gtggtttgga tgttatgtcc      1560
     cctgtccgcc tgtagtgctg gtgtggtgag acacagagtc gtcactgctc tggtatagaa      1620
     gagttttgtc taccaagagt gtcatggcat acctttggaa cttcatcaaa tgcacttgag      1680
     gatgacctgg gtcaggaagt agccaggtaa aagcagcggg actgtaggcg atgctccatt      1740
     agactccgtg cagagcagca ggtgcacagc atagctgggt gtgcggctga ccaggagagg      1800
     gtctgactcc gcaccagcag aacagcaggg tctccagcac gtgtgggaag cacgtgggag      1860
     agggttgagg aaggatgcac agatgtggac agagaagcat aaaaatgtcg ggaactccta      1920
     gtagggtcca ccttaaaatc gctttatagt ctctggcttt gttactctgt aagattacac      1980
     ttgtttctgg atatctgaat ccaaataagc atcatatttt aagaagctct gtttctgaac      2040
     ttccaggggg aaatctgttt aatgtgttta ctcctagcat actacagaat tttctagctc      2100
     tatagcttct tacctagcgt ttccatagtg ctgagcttca ttactacacg cccttcctag      2160
     taataaaatt ctcaccttca agcatgaatc aaaaacaaat atctataata cacaggttca      2220
     attttataga attgctattt tctctagtgc atatctcatt aaaagtaact ttttaggaat      2280
     aatctttata tgggtacata ttttggtaca taaaatagaa aatgttctta aactcatttt      2340
     gtattatttg aatagttaca agatgatttg tggtatcatg ggtacccatt ataaaccatg      2400
     ctcttcccag tagctgacga actcaaggta tcacagcctt ctaagaagcc gacttagaac      2460
     atggctgtac atgaatatta tacattaagg tgtcctctca cttctaccca gagtgcctct      2520
     gttcaaaggt gccttggaaa catttcagcc ccttccttct tagctcccac agggctgtgg      2580
     gtgttcttga aatcaggagg cgttttgaag gaccacagct gctccatttc agccgctgat      2640
     tcttaggaaa gttcatgctc tgacagaagt gtgctttgat ggcttctagc ggtgcatctc      2700
     gtctcgtttt ctttgtttgt ttttgttgtt gctatcatgg tttggtttgg ttttgagaca      2760
     ggatctctgt gcagccctgg ctggcctgga atgtactatg tagaccaggc tggctctcct      2820
     catgttttct tagtgatggc cataaacatt gttaaaatac atcaccatct tttaaaaact      2880
     tttcattatt aaaatttaaa atatagcatg tcattttttt accccataca tttgctatgg      2940
     aaaatttttt aaaccacctg ctttaacttt tttattgccc tgtttttcct attagaattg      3000
     atccccactg aggtaaattt tataatcatg ttttgtgtat ttttcctggc tcgccaaggc      3060
     ttatgaagaa atagcagcca ttccctgaca ggtttgcgct cccaccacag agaggctgag      3120
     caagatgatc agaggatcaa ggccagccag agcaaggcac tgcccagaaa gcacaagtcc      3180
     tgtgctcagc gttttgcgta gcgttttatt cctaattgaa atgtaatatt tcagaagcta      3240
     gcagcctcgc tcagtctaga ccttccacac caatctagca gcgattctcc cgtactaaag      3300
     cctttgtaag agtttacggt tcttcctcag tgaaaaatga tcttgttttt cttacagccg      3360
     gatccaaaga cgctagatgt taagggctga ggctgaagcc cggtgacggg gcgctcacct      3420
     gtcatggtgc agccctcgtt ccaccgtgag caccagcaag agacaaacac aagcttgtga      3480
     gtcagaggcc gttattaaat tcatacgcac atactcccta tagcgagaca tgggcttatg      3540
     ggcaggcttt tttttcataa catttatgag aaaacaatgt tttccccata acatttaatt      3600
     aggactgtag cttattggta attaaggtac aaaatcaaag tcgagtagaa tgtactgttc      3660
     acacagcgtg ttgtgaaagg ggtcctcaca ccaaagttta actgtaaagt ttagaaaaat      3720
     aacattgtca ttagcatatt tgaacacata tttggaattt ctaaaaagca tcaaaataga      3780
     aaaagaaagt gaaactctgg agaatgagat gctgaagatg ggctatgatt taaaggtctg      3840
     ttctgtagtt agaaagcacc ttttaaagac tttgttcatt cccaagagtc tatgttgatt      3900
     gcatttaaca tgaccgacaa cttatatatg taattgtgta cattttcatt ggttgtctct      3960
     gtagtccaaa agaaggtatt ttaataaaaa atagaaatg                             3999
//


spacer
spacer