spacer

EBI Dbfetch

ID   AK168547; SV 1; linear; mRNA; HTC; MUS; 3990 BP.
XX
AC   AK168547;
XX
DT   09-SEP-2005 (Rel. 85, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 10)
XX
DE   Mus musculus 13 days embryo liver cDNA, RIKEN full-length enriched library,
DE   clone:I920030M05 product:twisted gastrulation homolog 1 (Drosophila), full
DE   insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-3990
RA   Arakawa T., Carninci P., Fukuda S., Hashizume W., Hayashida K., Hori F.,
RA   Iida J., Imamura K., Imotani K., Itoh M., Kanagawa S., Kawai J., Kojima M.,
RA   Konno H., Murata M., Nakamura M., Ninomiya N., Nishiyori H., Nomura K.,
RA   Ohno M., Sakazume N., Sano H., Sasaki D., Shibata K., Shiraki T.,
RA   Tagami M., Tagami Y., Waki K., Watahiki A., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (14-APR-2004) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; b6e77aeb1d39e82ecea077decd1ca9c8.
DR   Ensembl-Gn; ENSMUSG00000024098; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000024906; mus_musculus.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=I920030M05
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3990
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /dev_stage="13 days embryo"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="I920030M05"
FT                   /tissue_type="liver"
FT                   /db_xref="taxon:10090"
FT   CDS             109..777
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="putative"
FT                   /note="twisted gastrulation homolog 1 (Drosophila)
FT                   (MGD|MGI:2137520 GB|AK049646, evidence: BLASTN, 99%,
FT                   match=3981)"
FT                   /db_xref="GOA:Q9EP52"
FT                   /db_xref="InterPro:IPR006761"
FT                   /db_xref="MGI:MGI:2137520"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9EP52"
FT                   /protein_id="BAE40422.1"
FT                   /translation="MKSHYIVLALASLTFLLCLPVSQSCNKALCASDVSKCLIQELCQC
FT                   RPGEGNCPCCKECMLCLGALWDECCDCVGMCNPRNYSDTPPTSKSTVEELHEPIPSLFR
FT                   ALTEGDTQLNWNIVSFPVAEELSHHENLVSFLETVNQLHHQNVSVPSNNVHAPFPSDKE
FT                   RMCTVVYFDDCMSIHQCKISCESMGASKYRWFHNACCECIGPECIDYGSKTVKCMNCMF
FT                   "
FT   polyA_signal    3974..3979
FT                   /note="putative"
FT   polyA_site      3990
FT                   /note="putative"
XX
SQ   Sequence 3990 BP; 1062 A; 872 C; 903 G; 1153 T; 0 other;
     aggtgtccgc ggcgccgggg ttcgcgggag ctgcttggag gctcggcggc cgggaggagg        60
     ccggggccac gcttcttgga agctactgag tgacttcttt aaagaaccat gaagtcacac       120
     tatattgtgc tagctctagc ctccctgacg ttcctgctgt gtctccccgt gtcccagagc       180
     tgtaacaaag cactctgtgc cagcgatgtg agcaaatgcc tcattcagga gctctgccag       240
     tgccggcctg gagaagggaa ctgcccctgc tgtaaggagt gcatgctgtg cctcggggcc       300
     ctgtgggacg agtgctgcga ctgtgtcggt atgtgcaacc ctcggaatta cagcgacacc       360
     ccgcccacat ccaagagcac cgtggaggag ctgcacgagc ccattccgtc cctgttcagg       420
     gcgctgacgg agggcgacac ccagctgaac tggaacatcg tctccttccc tgtggcagag       480
     gagctgtcac accatgaaaa cctagtctcc ttcctagaaa ctgtgaacca gctgcaccac       540
     caaaacgtgt ctgttcccag caacaatgtc cacgccccct tccccagcga caaagagcgc       600
     atgtgcacag tggtttactt tgatgactgc atgtccatcc accaatgtaa gatatcctgc       660
     gaatccatgg gtgcatccaa gtatcgctgg tttcacaacg cctgctgcga gtgcatcggt       720
     ccagagtgca ttgactatgg gagtaaaact gtcaagtgta tgaactgcat gttttaaaga       780
     gggggaagaa atgcaaacca aagcagtaag tcatgaagtg tgcagaaatc ttggttctgg       840
     tatgctagga gtgtgttaag ttatatgatt gtaactgtgc tttttatatc tggtgcctat       900
     tagtgtaggt cttttccatt ggattcaatg gaactttagt cacatgagga tcgggagttc       960
     agaggagtcc tgggaaaacc tgacatgctg acagaaggtg ccgtcttctt ccagctttcc      1020
     aaacacttct cgttttgaac gtgatagcac aagcctggta catgtgtggt tctcacctgc      1080
     cagttgtaga acactaggtc cctatagtca cacatctctt aattgtgcct tggctggctt      1140
     acctgttttg tatgagtaaa tattacagtt tataattcta acaactcaca ttcaagccat      1200
     gctgaaactt aatttcaaac cactttacat tggttttaga aagtaaatat ttactatatt      1260
     ttacaacaga agagttttgc ctagggccag cgagctgact cagtggataa aggcgcttgc      1320
     taccaagcct gataacctga gttccatccc cagagcccgt acagtggaag gacaggacca      1380
     gctgctggga gttgtcctct gacctccaga caggcacagt atcatgcgtg gaggtgtgct      1440
     tgtgtgtgca cacacataac taactgtttt taaaaatata aacctcttac atggtgaaat      1500
     ctaaatctgt cgtgtagctc tcacactgac agtggtttgg atgttatgtc ccctgtccgc      1560
     ctgtagtgct ggtgtggtga gacacagagt cgtcactgct ctggtataga agagttttgt      1620
     ctaccaagag tgtcatggca tacctttgga acttcatcaa atgcacttga ggatgacctg      1680
     ggtcaggaag tagccaggta aaagcagcgg gactgtaggc gatgctccat tagactccgt      1740
     gcagagcagc aggtgcacag catagctggg tgtgcggctg accaggagag ggtctgactc      1800
     cgcaccagca gaacagcagg gtctccagca cgtgtgggaa gcacgtggga gagggttgag      1860
     gaaggatgca cagatgtgga cagagaagca taaaaatgtc gggaactcct agtagggtcc      1920
     accttaaaat cgctttatag tctctggctt tgttactctg taagattaca cttgtttctg      1980
     gatatctgaa tccaaataag catcatattt taagaagctc tgtttctgaa cttccagggg      2040
     gaaatctgtt taatgtgttt actcctagca tactacagaa ttttctagct ctatagcttc      2100
     ttacctagcg tttccatagt gctgagcttc attactacac gcccttccta gtaataaaat      2160
     tctcaccttc aagcatgaat caaaaacaaa tatctataat acacaggttc aattttatag      2220
     aattgctatt ttctctagtg catatctcat taaaagtaac tttttaggaa taatctttat      2280
     atgggtacat attttggtac ataaaataga aaatgttctt aaactcattt tgtattattt      2340
     gaatagttac aagatgattt gtggtatcat gggtacccat tataaaccat gctcttccca      2400
     gtagctgacg aactcaaggt atcacagcct tctaagaagc cgacttagaa catggctgta      2460
     catgaatatt atacattaag gtgtcctctc acttctaccc agagtgcctc tgttcaaagg      2520
     tgccttggaa acatttcagc cccttccttc ttagctccca cagggctgtg ggtgttcttg      2580
     aaatcaggag gcgttttgaa ggaccacagc tgctccattt cagccgctga ttcttaggaa      2640
     agttcatgct ctgacagaag tgtgctttga tggcttctag cggtgcatct cgtctcgttt      2700
     tctttgtttg tttttgttgt tgctatcatg gtttggtttg gttttgagac aggatctctg      2760
     tgcagccctg gctggcctgg aatgtactat gtagaccagg ctggctctcc tcatgttttc      2820
     ttagtgatgg ccataaacat tgttaaaata catcaccatc ttttaaaaac ttttcattat      2880
     taaaatttaa aatatagcat gtcatttttt taccccatac atttgctatg gaaaattttt      2940
     taaaccacct gctttaactt ttttattgcc ctgtttttcc tattagaatt gatccccact      3000
     gaggtaaatt ttataatcat gttttgtgta tttttcctgg ctcgccaagg cttatgaaga      3060
     aatagcagcc attccctgac aggtttgcgc tcccaccaca gagaggctga gcaagatgat      3120
     cagaggatca aggccagcca gagcaaggca ctgcccagaa agcacaagtc ctgtgctcag      3180
     cgttttgcgt agcgttttat tcctaattga aatgtaatat ttcagaagct agcagcctcg      3240
     ctcagtctag accttccaca ccaatctagc agcgattctc ccgtactaaa gcctttgtaa      3300
     gagtttacgg ttcttcctca gtgaaaaatg atcttgtttt tcttacagcc ggatccaaag      3360
     acgctagatg ttaagggctg aggctgaagc ccggtgacgg ggcgctcacc tgtcatggtg      3420
     cagccctcgt tccaccgtga gcaccagcaa gagacaaaca caagcttgtg agtcagaggc      3480
     cgttattaaa ttcatacgca catactccct atagcgagac atgggcttat gggcaggctt      3540
     ttttttcata acatttatga gaaaacaatg ttttccccat aacatttaat taggactgta      3600
     gcttattggt aattaaggta caaaatcaaa gtcgagtaga atgtactgtt cacacagcgt      3660
     gttgtgaaag gggtcctcac accaaagttt aactgtaaag tttagaaaaa taacattgtc      3720
     attagcatat ttgaacacat atttggaatt tctaaaaagc atcaaaatag aaaaagaaag      3780
     tgaaactctg gagaatgaga tgctgaagat gggctatgat ttaaaggtct gttctgtagt      3840
     tagaaagcac cttttaaaga ctttgttcat tcccaagagt ctatgttgat tgcatttaac      3900
     atgaccgaca acttatatat gtaattgtgt acattttcat tggttgtctc tgtagtccaa      3960
     aagaaggtat tttaataaaa aatagaaatg                                       3990
//


spacer
spacer