spacer

EBI Dbfetch

ID   AK168248; SV 1; linear; mRNA; HTC; MUS; 1001 BP.
XX
AC   AK168248;
XX
DT   09-SEP-2005 (Rel. 85, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 10)
XX
DE   Mus musculus CRL-1722 L5178Y-R cDNA, RIKEN full-length enriched library,
DE   clone:I730071G06 product:prohibitin, full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1001
RA   Arakawa T., Carninci P., Fukuda S., Hashizume W., Hayashida K., Hori F.,
RA   Iida J., Imamura K., Imotani K., Itoh M., Kanagawa S., Kawai J., Kojima M.,
RA   Konno H., Murata M., Nakamura M., Ninomiya N., Nishiyori H., Nomura K.,
RA   Ohno M., Sakazume N., Sano H., Sasaki D., Shibata K., Shiraki T.,
RA   Tagami M., Tagami Y., Waki K., Watahiki A., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (14-APR-2004) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; 8243195ec28d5c184084ec139408b36c.
DR   Ensembl-Gn; ENSMUSG00000038845; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000125172; mus_musculus.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=I730071G06
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1001
FT                   /organism="Mus musculus"
FT                   /strain="DBA/2"
FT                   /mol_type="mRNA"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="I730071G06"
FT                   /cell_line="CRL-1722 L5178Y-R"
FT                   /db_xref="taxon:10090"
FT   CDS             62..880
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="prohibitin (MGD|MGI:97572 GB|NM_008831, evidence:
FT                   BLASTN, 99%, match=995)"
FT                   /note="putative"
FT                   /db_xref="GOA:P67778"
FT                   /db_xref="InterPro:IPR000163"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="MGI:MGI:97572"
FT                   /db_xref="UniProtKB/Swiss-Prot:P67778"
FT                   /protein_id="BAE40198.1"
FT                   /translation="MAAKVFESIGKFGLALAVAGGVVNSALYNVDAGHRAVIFDRFRGV
FT                   QDIVVGEGTHFLIPWVQKPIIFDCRSRPRNVPVITGSKDLQNVNITLRILFRPVASQLP
FT                   RIYTSIGEDYDERVLPSITTEILKSVVARFDAGELITQRELVSRQVSDDLTERAATFGL
FT                   ILDDVSLTHLTFGKEFTEAVEAKQVAQQEAERARFVVEKAEQQKKAAIISAEGDSKAAE
FT                   LIANSLATAGDGLIELRKLEAAEDIAYQLSRSRNITYLPAGQSVLLQLPQ"
FT   polyA_signal    982..987
FT                   /note="putative"
FT   polyA_site      1001
FT                   /note="putative"
XX
SQ   Sequence 1001 BP; 236 A; 260 C; 294 G; 211 T; 0 other;
     gggggaattc atgtggaggt cagagtgaaa gcaggtgtga gtggaagcaa cagaaggagt        60
     catggctgcc aaagtgtttg agtccattgg aaagttcggc ctggcgttgg cagttgcagg       120
     aggcgtggtg aactctgctt tgtataatgt ggatgctgga cacagagctg tcatctttga       180
     ccgattccgt ggcgtacagg acattgtggt cggggaaggg actcatttcc tcatcccttg       240
     ggtacagaaa ccaattatct ttgactgccg ctctcgacca cggaacgtac cggtcatcac       300
     tggtagcaaa gacttgcaga acgtcaatat cacactgcga atcctcttcc ggccggtggc       360
     cagccagctt cctcgtatct acaccagcat tggcgaggac tatgatgagc gggtcctgcc       420
     ttctatcacc acagagatcc tcaagtcggt ggtggctcga ttcgatgctg gagaattgat       480
     tacccagcga gagctggtct ccaggcaggt gagcgatgac ctcacagagc gagcggcaac       540
     atttgggctt atcctggatg acgtgtccct gacacatctg accttcggga aggagttcac       600
     agaggcagta gaagccaaac aggtggctca gcaggaagcg gagagagcca gatttgtggt       660
     ggaaaaggct gagcagcaga agaaggcagc catcatctct gctgagggtg actccaaggc       720
     cgctgagctg atcgccaact cgctggccac ggcaggcgac ggcctgatcg agctgcggaa       780
     gctggaggcc gccgaggaca ttgcgtacca gctctcccgc tctcggaaca tcacctacct       840
     gccagcgggc cagtccgtgc ttctccagct tccccagtga ggccagccgg gccacggcct       900
     ccatcatgct gaatgacgcc ttccttctgc cgcaccccag aaaatcactg tgaaatttca       960
     tgattggctt aaagtgaagg aaataaaggt aaaatcactt c                          1001
//


spacer
spacer