Dbfetch

ID   AK168141; SV 1; linear; mRNA; HTC; MUS; 2955 BP.
XX
AC   AK168141;
XX
DT   09-SEP-2005 (Rel. 85, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 10)
XX
DE   Mus musculus cDNA, RIKEN full-length enriched library, clone:I730060F12
DE   product:protein phosphatase 1, catalytic subunit, beta isoform, full insert
DE   sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2955
RA   Arakawa T., Carninci P., Fukuda S., Hashizume W., Hayashida K., Hori F.,
RA   Iida J., Imamura K., Imotani K., Itoh M., Kanagawa S., Kawai J., Kojima M.,
RA   Konno H., Murata M., Nakamura M., Ninomiya N., Nishiyori H., Nomura K.,
RA   Ohno M., Sakazume N., Sano H., Sasaki D., Shibata K., Shiraki T.,
RA   Tagami M., Tagami Y., Waki K., Watahiki A., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (14-APR-2004) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science, e1252229 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science, e1252229 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; 70ac311659feb925b9ee07ce6473c6c0.
DR   Ensembl-Gn; ENSMUSG00000014956; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0029435; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0029401; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0029351; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0029412; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0029133; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0029865; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0028543; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0029101; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0029250; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0029208; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0029335; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0029237; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0029899; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0028268; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0028624; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000015100; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000201360; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0070976; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0071059; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0070960; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0070984; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0070630; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0071464; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0071166; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0070570; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0070707; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0070617; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0070780; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0070642; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0071660; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0070636; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0069787; mus_musculus_wsbeij.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=I730060F12
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2955
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="I730060F12"
FT                   /note="pooled tissues: (sex=mix,cell_line=TIB-55
FT                   BB88),(sex=mix,cell_line=CRL-1722 L5178Y-R)"
FT                   /db_xref="taxon:10090"
FT   CDS             284..1267
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="protein phosphatase 1, catalytic subunit, beta
FT                   isoform (MGD|MGI:104871 GB|NM_172707, evidence: BLASTN,
FT                   99%, match=2768)"
FT                   /note="putative"
FT                   /db_xref="GOA:P62141"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR006186"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR031675"
FT                   /db_xref="MGI:MGI:104871"
FT                   /db_xref="UniProtKB/Swiss-Prot:P62141"
FT                   /protein_id="BAE40108.1"
FT                   /translation="MADGELNVDSLITRLLEVRGCRPGKIVQMTEAEVRGLCIKSREIF
FT                   LSQPILLELEAPLKICGDIHGQYTDLLRLFEYGGFPPEANYLFLGDYVDRGKQSLETIC
FT                   LLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRFNIKLWKTFTDCFNCLPIAAI
FT                   VDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDTGLLCDLLWSDPDKDVQGWGENDRGV
FT                   SFTFGADVVSKFLNRHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGGM
FT                   MSVDETLMCSFQILKPSEKKAKYQYGGLNSGRPVTPPRTANPPKKR"
XX
SQ   Sequence 2955 BP; 802 A; 515 C; 658 G; 980 T; 0 other;
     ggtggaggag gcggtggcgg ctggggtctg acgcggcccg gttcctgacg cggcccggtt        60
     cctgggggcc tgcttgttta tttatttatt tccagtgggc gccgccagcg tgtgcgcgcg       120
     ctgtcgctgc tcggcgggga gggggtgggg ggagggcccg cgcccggggg gagttggagc       180
     cggggtcgaa acgccgcgtg actcgtaggt gagaacgccg agccgccgcc gccgccgaga       240
     agccctatta acgctttagg gaggagagtc tggtgccgac aagatggcgg acggggagct       300
     gaacgtggac agcctcatca cccgcctgct ggaggtacga ggatgtcgtc caggaaagat       360
     tgtacaaatg actgaagcag aagtccgagg gttgtgtatc aagtctcgtg aaatctttct       420
     cagccagcct attcttttgg aattggaagc accactgaag atttgtggag acattcatgg       480
     acaatataca gacttactaa gattatttga atatggaggt tttccaccag aagccaacta       540
     tcttttctta ggagattatg tggacagagg aaagcagtct ttggaaacca tctgtttgct       600
     attggcttac aaaatcaaat acccggagaa cttctttctt ctaagaggaa accatgagtg       660
     tgctagcatc aatcgcattt atggattcta cgatgagtgt aaacgaagat ttaatattaa       720
     attgtggaag acattcactg attgttttaa ctgtctgcct atagctgcta ttgttgatga       780
     gaaaatcttc tgttgtcatg gaggactgtc accagaccta caatctatgg aacagattcg       840
     gagaattatg agacccactg acgtacctga tacaggtttg ctttgtgact tactgtggtc       900
     cgacccagat aaggatgtgc aaggctgggg agaaaatgac cgtggtgttt cttttacttt       960
     tggagctgat gtagtcagta aatttctgaa tcgtcatgat ttagacttga tttgtcgagc      1020
     tcatcaggtg gtggaagacg gatatgaatt ttttgctaaa cgacagttgg taaccttatt      1080
     ttctgcccca aattactgtg gcgagtttga caatgctggt ggtatgatga gtgtggatga      1140
     gactttgatg tgttcattcc agatattgaa accatctgaa aagaaagcta agtaccagta      1200
     tggtgggctg aattctggac gtcctgtcac tccgcctcga acagctaatc caccgaagaa      1260
     aaggtgaaga caggaattct agaaagagaa accatcagat ttgttaagga catacttcat      1320
     aatatataag tgtgcactgt aaaaccatcc agccattcga caccctttat gatgtcacac      1380
     ctttaactta aggagacggt aaaggatctt aaattttttt ctaatagaaa gatgtgctac      1440
     actgtattgt aataagtata ctctgttata atattcaaca aaattaaatc caaattcaaa      1500
     agtatccatt aaagttctat cttctcatat cacagttttt aaagttgaaa agcatcccag      1560
     ttaaactagc cctgttagtg acccagatga aagcatgaag atccatctgt gtaatgtggt      1620
     tttagtggtg cttggttgtt tcattatttt gagcttgttt tgttttgttt gtttttgcta      1680
     gaataatggc atctactttt cctatttttc cctaaacatt tttaaaagtg aaaatgggaa      1740
     gagctttaaa gacattcacc aactattctt ttcctttact tatctactta agtaactgtt      1800
     ggatcttact aagaaaactt acccctcatt acagtaaaaa ggaactttag aggtcgatag      1860
     gttttaaaaa tatacaaact tctgatccat tgattttaat caaacagttt gactgggcaa      1920
     actttgcagc tgataatgag tatttcgctt tttacaaaat tgccactgat ttggatttgt      1980
     gcactctaat ctttaattta ttgatgctct attgtgcagt agcatttcat ttaagataag      2040
     gctcatatag taatatccaa aactagttgg taatgtgatt atgtggtact ttggctttgg      2100
     gttctaattc gcacgaaaca ccttttggca tgcttaactt tctggtatta ccctcacctg      2160
     cattggtttt gttttttggg gtttttgttg tttgtttgtt tttagattca cagaacatga      2220
     gaatcctttt tgacaagcct tggatagctg gctctcttct ttccctctct ctatgtgaag      2280
     gatgtattta aatgaacgct ggtcagtggg acatttgtca gctctgaata ttgggtgctt      2340
     cactaataat tgccatgtga atgttgtttt gactgtaagg ctatgtcact aaagattttt      2400
     actctgcgtt ttcataatca aaggtcatga tgtgtataga catgctttgt agtgaagtat      2460
     agtagcaata atttctgtat gtgatcaaga gtttattgca ttatttcttt ccctgttctc      2520
     tttttttttt tttaagggtt agcattaaca aatgtcaagg agtagcaaag tcaacaaaga      2580
     ttttagaagg aggggaacta agagcataca cagacttatg attctttgga tgtgacactt      2640
     attggatgtg attctaaagt cttttattga acattgtcaa attcgtacgc ttcataggat      2700
     ggacataatg tttatataat gcccttctta tgtgttacca tagatgtgtg aaaccttata      2760
     gcgtccttga aagtgttaag ttgagaactc tgttaacatt ttatggattg acacattata      2820
     ttactgcaag taacatttga ttttcggcac agtgcaaaag ttctttaaaa tgcatatgtc      2880
     ttttttttct aattccattt tgtttaaagc acattttaaa tgtagttttc tcatttagta      2940
     aaagttgtct aattg                                                       2955
//