Dbfetch

ID   AK167896; SV 1; linear; mRNA; HTC; MUS; 1993 BP.
XX
AC   AK167896;
XX
DT   09-SEP-2005 (Rel. 85, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 10)
XX
DE   Mus musculus CRL-1722 L5178Y-R cDNA, RIKEN full-length enriched library,
DE   clone:I730035K22 product:Adiponectin receptor protein 1, full insert
DE   sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1993
RA   Arakawa T., Carninci P., Fukuda S., Hashizume W., Hayashida K., Hori F.,
RA   Iida J., Imamura K., Imotani K., Itoh M., Kanagawa S., Kawai J., Kojima M.,
RA   Konno H., Murata M., Nakamura M., Ninomiya N., Nishiyori H., Nomura K.,
RA   Ohno M., Sakazume N., Sano H., Sasaki D., Shibata K., Shiraki T.,
RA   Tagami M., Tagami Y., Waki K., Watahiki A., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (14-APR-2004) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science, e1252229 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science, e1252229 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; e05e311e4c5ed4f754bb67aa65d1506c.
DR   Ensembl-Gn; ENSMUSG00000026457; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0016507; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0016490; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0016455; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0016450; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0016276; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0016911; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0015856; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0016249; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0016355; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0016354; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0016426; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0016379; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0016947; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0015642; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0015919; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000027727; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000112237; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0022230; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0022198; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0022166; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0022169; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0021976; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0022682; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0021505; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0021917; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0022046; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0022058; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0022150; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0022029; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0022715; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0021238; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0021553; mus_musculus_wsbeij.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=I730035K22
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1993
FT                   /organism="Mus musculus"
FT                   /strain="DBA/2"
FT                   /mol_type="mRNA"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="I730035K22"
FT                   /cell_line="CRL-1722 L5178Y-R"
FT                   /db_xref="taxon:10090"
FT   CDS             190..1317
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="Adiponectin receptor protein 1 (UniProt|Q91VH1,
FT                   evidence: FASTY, 100%ID, 100%length, match=1125)"
FT                   /note="putative"
FT                   /db_xref="GOA:Q53YY4"
FT                   /db_xref="InterPro:IPR004254"
FT                   /db_xref="MGI:MGI:1919924"
FT                   /db_xref="UniProtKB/TrEMBL:Q53YY4"
FT                   /protein_id="BAE39907.1"
FT                   /translation="MSSHKGSAGAQGNGAPSGNREADTVELAELGPLLEEKGKRAASSP
FT                   AKAEEDQACPVPQEEEEEVRVLTLPLQAHHAMEKMEEFVYKVWEGRWRVIPYDVLPDWL
FT                   KDNDYLLHGHRPPMPSFRACFKSIFRIHTETGNIWTHLLGFVLFLFLGILTMLRPNMYF
FT                   MAPLQEKVVFGMFFLGAVLCLSFSWLFHTVYCHSEKVSRTFSKLDYSGIALLIMGSFVP
FT                   WLYYSFYCSPQPRLIYLSIVCVLGISAIIVAQWDRFATPKHRQTRAGVFLGLGLSGVVP
FT                   TMHFTIAEGFVKATTVGQMGWFFLMAVMYITGAGLYAARIPERFFPGKFDIWFQSHQIF
FT                   HVLVVAAAFVHFYGVSNLQEFRYGLEGGCTDDSLL"
FT   regulatory      1977..1982
FT                   /note="putative"
FT                   /regulatory_class="polyA_signal_sequence"
FT   polyA_site      1993
FT                   /note="putative"
XX
SQ   Sequence 1993 BP; 444 A; 528 C; 504 G; 517 T; 0 other;
     ggaggatcgg gcgcccctcg gccgcaggcc gcctccagtg ccgcgggatg tagcgcccgg        60
     gcccgcggcc cccagcagag gcagccagcc aggcctgtcc accatcacag gaagatctct       120
     gccctctggg gctgagagac cccaaccttt cttcaagctg aagctgccag gcactgaggt       180
     accagccaga tgtcttccca caaaggctct gccggggcac aaggcaatgg ggctccttct       240
     ggtaacagag aagctgacac agtggagctg gctgagctgg ggcccctgct ggaggagaag       300
     ggcaagcggg cagccagcag cccagccaag gctgaggaag atcaagcatg cccggtgcct       360
     caggaagagg aggaggaggt gcgggtgctg acgcttcctc tgcaagccca ccatgccatg       420
     gagaagatgg aggagttcgt gtataaggtc tgggagggac gttggagagt catcccgtat       480
     gatgtgcttc ctgactggct gaaagacaac gactacctgc tacatggcca cagaccacct       540
     atgccctcct ttcgggcttg cttcaagagc atcttccgca tccacacaga gactggcaac       600
     atctggacac atctgcttgg ttttgtgcta tttctctttc tgggaatctt gacgatgctg       660
     agaccaaata tgtacttcat ggctcccctg caggagaagg tggtcttcgg gatgttcttc       720
     ctgggcgcgg tgctctgcct cagtttctcc tggctcttcc acactgtcta ctgtcattca       780
     gagaaggtct ctcggacttt ttccaaactg gactattcag ggattgctct actgattatg       840
     gggagcttcg ttccctggct ctattactcc ttctactgct ccccacagcc gcggctcatc       900
     tacctctcca tcgtctgtgt actgggcatc tctgccatca ttgtggcaca gtgggaccgg       960
     tttgccactc ccaagcaccg gcagacaaga gcaggagtgt tcctgggact tggcttgagt      1020
     ggtgttgtac ccaccatgca ctttactatc gctgagggct ttgtcaaggc caccacggtg      1080
     ggccagatgg gctggttctt cctcatggct gtgatgtaca tcaccggcgc cggcctgtat      1140
     gctgctcgga ttcctgagcg cttcttccct ggaaaatttg acatctggtt ccagtctcat      1200
     cagattttcc acgtcctggt ggtggcagca gctttcgtcc acttctatgg tgtgtccaac      1260
     cttcaggaat tccgttatgg cctagaaggt ggctgtaccg acgactccct tctctgagcc      1320
     tccccacctg aggggtggag gagggacttc ccaagtgctt ttaaaaataa cttctttgct      1380
     gaagtatgag gaagagtctg agttgtctgt ttctagaaga aatctcttag agaagtcagt      1440
     accagtgaca tgtcagctca ctgtcccagc ctccgtccgg gcagtacact tcccatgtgc      1500
     attcccggca gtcacctcgg caaggcaact gctgctcctt cacagatagg acgtgggagc      1560
     tcatgttgag attttaccca ttcctccagc cattttggga aaaaaaaaat tatgaactgg      1620
     gattcttcag aaattatgtt ttgttttttc ttgaagaaaa tatccccccc ttacccccgt      1680
     ccttactttg taacctggct gataacgggc catccatttt tgtagcacac ttttcagaaa      1740
     caattataac ctggtcccat ctttctagga caaacaaagc cacgccttga tgtagcccgg      1800
     ctaatcatgg aagtacgtcc aggcttcaaa taacttgagt ttaaatcctt tttttttttt      1860
     tttcttggca gagtaatgta aaattaaaat ggggaagata tttaatattt aatactaagc      1920
     tttaaaaaga aacctgctat cactgctatg tatcttgatg caaagactat ggtgataata      1980
     aaagaaagta tag                                                         1993
//