spacer

EBI Dbfetch

ID   AK167140; SV 1; linear; mRNA; HTC; MUS; 1683 BP.
XX
AC   AK167140;
XX
DT   09-SEP-2005 (Rel. 85, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 10)
XX
DE   Mus musculus blastocyst blastocyst cDNA, RIKEN full-length enriched
DE   library, clone:I1C0033N08 product:adipose differentiation related protein,
DE   full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1683
RA   Arakawa T., Carninci P., Fukuda S., Hashizume W., Hayashida K., Hori F.,
RA   Iida J., Imamura K., Imotani K., Itoh M., Kanagawa S., Kawai J., Kojima M.,
RA   Konno H., Murata M., Nakamura M., Ninomiya N., Nishiyori H., Nomura K.,
RA   Ohno M., Sakazume N., Sano H., Sasaki D., Shibata K., Shiraki T.,
RA   Tagami M., Tagami Y., Waki K., Watahiki A., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (14-APR-2004) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; b15e531e3c95e36415f1d34694c54a09.
DR   Ensembl-Gn; ENSMUSG00000028494; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000000466; mus_musculus.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=I1C0033N08
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1683
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /dev_stage="blastocyst"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="I1C0033N08"
FT                   /cell_type="blastocyst"
FT                   /db_xref="taxon:10090"
FT   CDS             80..1357
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="adipose differentiation related protein
FT                   (MGD|MGI:87920 GB|NM_007408, evidence: BLASTN, 99%,
FT                   match=1680)"
FT                   /note="putative"
FT                   /db_xref="GOA:P43883"
FT                   /db_xref="InterPro:IPR004279"
FT                   /db_xref="MGI:MGI:87920"
FT                   /db_xref="UniProtKB/Swiss-Prot:P43883"
FT                   /protein_id="BAE39285.1"
FT                   /translation="MAAAVVDPQQSVVMRVANLPLVSSTYDLVSSAYVSTKDQYPYLRS
FT                   VCEMAEKGVKTVTSAAMTSALPIIQKLEPQIAVANTYACKGLDRMEERLPILNQPTSEI
FT                   VASARGAVTGAKDVVTTTMAGAKDSVASTVSGVVDKTKGAVTGSVERTKSVVNGSINTV
FT                   LGMVQFMNSGVDNAITKSELLVDQYFPLTQEELEMEAKKVEGFDMVQKPSNYERLESLS
FT                   TKLCSRAYHQALSRVKEAKQKSQETISQLHSTVHLIEFARKNMHSANQKIQGAQDKLYV
FT                   SWVEWKRSIGYDDTDESHCVEHIESRTLAIARNLTQQLQTTCQTVLVNAQGLPQNIQDQ
FT                   AKHLGVMAGDIYSVFRNAASFKEVSDGVLTSSKGQLQKMKESLDEVMDYFVNNTPLNWL
FT                   VGPFYPQSTEVNKASLKVQQSEVKAQ"
FT   regulatory      1665..1670
FT                   /note="putative"
FT                   /regulatory_class="polyA_signal_sequence"
FT   polyA_site      1683
FT                   /note="putative"
XX
SQ   Sequence 1683 BP; 420 A; 416 C; 460 G; 387 T; 0 other;
     ggtgtggtga tctggaccgt gcggacttgc tcgtccctca gctctcctgt taggcgtctc        60
     ttttctccag gaggaaaaaa tggcagcagc agtagtggat ccgcaacaga gcgtggtgat       120
     gagagtggcc aacctgccct tggtgagctc tacctacgac cttgtgtcct ccgcttatgt       180
     cagtacaaag gatcagtacc cgtatttgag atccgtgtgt gagatggccg agaagggcgt       240
     gaagaccgtg acctctgcgg ccatgacaag tgccctgccc atcatccaga agctggagcc       300
     acaaattgcg gttgccaata cctatgcctg caaggggcta gacaggatgg aggaaagact       360
     gcctattctg aaccagccaa cgtccgagat tgttgccagt gccagaggtg ccgtaactgg       420
     ggcgaaggat gtggtgacga ctaccatggc tggagccaag gattctgtag ccagcacagt       480
     ctcaggggtg gtggataaga ccaaaggagc agtgactggc agcgtggaaa ggaccaagtc       540
     tgtggtcaat ggcagcatca atacagtttt ggggatggtg cagttcatga acagtggagt       600
     agataatgcc atcaccaagt cggagctgct ggtagaccag tacttccctc tcactcagga       660
     ggagctggag atggaagcaa aaaaggtgga aggatttgat atggttcaga agccgagcaa       720
     ctatgaacgg ctggagtccc tgtctaccaa gctctgctct cgggcttatc accaggctct       780
     cagcagggtt aaagaggcca aacaaaagag ccaggagacc atttctcagc tccactccac       840
     tgtccacctg attgaattcg ccaggaagaa tatgcacagt gccaaccaga aaattcaggg       900
     tgctcaggat aagctctatg tctcgtgggt ggagtggaag agaagcatcg gctacgacga       960
     caccgatgag tcccactgtg ttgagcacat cgagtcacgt actctggcta tcgcccgcaa      1020
     cctgacccag cagctccaga ctacatgcca gactgtcctg gtcaacgccc aagggttacc      1080
     acagaacatt caagatcagg ccaaacactt gggggtgatg gcaggcgaca tctactccgt      1140
     attccgcaat gctgcctcct ttaaggaagt gtccgatggc gtcctcacat ctagcaaggg      1200
     gcagctgcag aaaatgaagg aatccttaga tgaagttatg gattactttg ttaacaacac      1260
     gcctctcaac tggctggtag gtccctttta tcctcagtct accgaggtga acaaggccag      1320
     cctgaaggtc cagcagtctg aggtcaaagc tcagtaaacc cctccttgtc accagagcat      1380
     gatgttgctg gccagatgac cccttttgct gtattgaaat taacttggta gatggcttta      1440
     gcttagaaaa gcagcttctt agaaccaagg gcctcattat ggtcactcac agctcagtta      1500
     tggtcttgcc ccagctggcc ctggcacagg agttctctta cctggctggt gagtggcctg      1560
     tgttagtctt gtgaggacct cgaggaacct aaaagctcag atgcacttac agtcttgtct      1620
     gtggcctttg tattgttatt ggctgtaaac gtctgtctgg accgaataaa gattcattca      1680
     cgt                                                                    1683
//


spacer
spacer