spacer

EBI Dbfetch

ID   AK166630; SV 1; linear; mRNA; HTC; MUS; 1234 BP.
XX
AC   AK166630;
XX
DT   09-SEP-2005 (Rel. 85, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 10)
XX
DE   Mus musculus 5 days embryo whole body cDNA, RIKEN full-length enriched
DE   library, clone:I0C0042H15 product:STIP1 homology and U-Box containing
DE   protein 1, full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1234
RA   Arakawa T., Carninci P., Fukuda S., Hashizume W., Hayashida K., Hori F.,
RA   Iida J., Imamura K., Imotani K., Itoh M., Kanagawa S., Kawai J., Kojima M.,
RA   Konno H., Murata M., Nakamura M., Ninomiya N., Nishiyori H., Nomura K.,
RA   Ohno M., Sakazume N., Sano H., Sasaki D., Shibata K., Shiraki T.,
RA   Tagami M., Tagami Y., Waki K., Watahiki A., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (14-APR-2004) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   Ensembl-Gn; ENSMUSG00000039615; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000044911; mus_musculus.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=I0C0042H15
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1234
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /dev_stage="5 days embryo"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="I0C0042H15"
FT                   /tissue_type="whole body"
FT                   /db_xref="taxon:10090"
FT   CDS             75..989
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="STIP1 homology and U-Box containing protein 1
FT                   (MGD|MGI:1891731 GB|NM_019719, evidence: BLASTN, 99%,
FT                   match=1232)"
FT                   /note="putative"
FT                   /db_xref="GOA:Q9WUD1"
FT                   /db_xref="InterPro:IPR001440"
FT                   /db_xref="InterPro:IPR003613"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="MGI:MGI:1891731"
FT                   /db_xref="PDB:2C2L"
FT                   /db_xref="PDB:2C2V"
FT                   /db_xref="PDB:3Q47"
FT                   /db_xref="PDB:3Q49"
FT                   /db_xref="PDB:3Q4A"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9WUD1"
FT                   /protein_id="BAE38905.1"
FT                   /translation="MKGKEEKEGGARLGTGGGGSPDKSPSAQELKEQGNRLFVGRKYPE
FT                   AAACYGRAITRNPLVAVYYTNRALCYLKMQQPEQALADCRRALELDGQSVKAHFFLGQC
FT                   QLEMESYDEAIANLQRAYSLAKEQRLNFGDDIPSALRIAKKKRWNSIEERRIHQESELH
FT                   SYLTRLIAAERERELEECQRNHEGHEDDGHIRAQQACIEAKHDKYMADMDELFSQVDEK
FT                   RKKRDIPDYLCGKISFELMREPCITPSGITYDRKDIEEHLQRVGHFDPVTRSPLTQEQL
FT                   IPNLAMKEVIDAFISENGWVEDY"
FT   polyA_signal    1219..1224
FT                   /note="putative"
FT   polyA_site      1234
FT                   /note="putative"
XX
SQ   Sequence 1234 BP; 264 A; 335 C; 397 G; 238 T; 0 other;
     ggggagctga tcgctgcgcg ggctgcgaga tctaggtggc cgggcgcgga gcccaagccg        60
     tgccgcgcgg cgccatgaag ggcaaggagg aaaaggaggg cggcgcgcgg ctgggcactg       120
     gtggcggcgg cagccctgat aagagcccga gtgcgcaaga gctcaaggag cagggaaacc       180
     ggctcttcgt gggccgcaag tacccggagg cggcggcctg ctacggccgc gccatcactc       240
     ggaacccact tgtggcagtg tactacacta accgggccct gtgctatctg aagatgcagc       300
     agcctgaaca ggcacttgct gactgccggc gagccctgga gctggacggg cagtctgtga       360
     aggcgcactt cttcctgggg cagtgccagc tggagatgga gagttatgat gaggccattg       420
     ccaatctgca gcgagcctat agtttggcca aggagcagcg actcaacttt ggggatgata       480
     ttcctagtgc ccttcgcatt gctaagaaga agcgctggaa cagtatagag gaacggcgca       540
     tccaccagga gagtgagctg cattcatatc tcaccaggct cattgctgct gagcgagaga       600
     gggaactgga ggagtgtcag cggaaccacg agggtcatga agatgatggc cacatccggg       660
     cccagcaggc ctgcattgag gccaagcacg ataaatacat ggcagatatg gatgagctct       720
     tctctcaggt ggacgagaaa agaaagaagc gagatatccc tgactacttg tgtggcaaga       780
     ttagctttga gctgatgcgg gaaccctgca ttacacccag tggtatcacc tatgaccgca       840
     aggacattga ggagcacctg cagcgtgtgg gccactttga ccctgtgacc cggagccctc       900
     tgacccagga acagctcatc cccaacttgg ccatgaagga agtcattgac gctttcatct       960
     ctgagaacgg ctgggtagag gactattgag gccccatgtc ctgcctggca ccctggccca      1020
     ggaggatctg gagacggaag ctccagtccc tgtatagttt gtgtccctgg gcctgccccc      1080
     atcggccctg ctgatgggtt ctgaactgct ccccttctca gcatacccct tgctggacca      1140
     tgagcctccc ttgtccccct tctgggctgg agagtgggtg agggtgggct gaggttgctg      1200
     ctgctgccac tgtcctgtaa taaagtctgt gagc                                  1234
//


spacer
spacer