spacer

EBI Dbfetch

ID   AK166623; SV 1; linear; mRNA; HTC; MUS; 2975 BP.
XX
AC   AK166623;
XX
DT   09-SEP-2005 (Rel. 85, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 10)
XX
DE   Mus musculus morula whole body morula cDNA, RIKEN full-length enriched
DE   library, clone:I0C0040K11 product:protein phosphatase 1, catalytic subunit,
DE   beta isoform, full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2975
RA   Arakawa T., Carninci P., Fukuda S., Hashizume W., Hayashida K., Hori F.,
RA   Iida J., Imamura K., Imotani K., Itoh M., Kanagawa S., Kawai J., Kojima M.,
RA   Konno H., Murata M., Nakamura M., Ninomiya N., Nishiyori H., Nomura K.,
RA   Ohno M., Sakazume N., Sano H., Sasaki D., Shibata K., Shiraki T.,
RA   Tagami M., Tagami Y., Waki K., Watahiki A., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (14-APR-2004) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; d91c757644d0defd82f1270e0432e6aa.
DR   Ensembl-Gn; ENSMUSG00000014956; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000015100; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000131300; mus_musculus.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=I0C0040K11
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2975
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /dev_stage="morula"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="I0C0040K11"
FT                   /cell_type="morula"
FT                   /tissue_type="whole body"
FT                   /db_xref="taxon:10090"
FT   CDS             290..1273
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="protein phosphatase 1, catalytic subunit, beta
FT                   isoform (MGD|MGI:104871 GB|NM_172707, evidence: BLASTN,
FT                   99%, match=2776)"
FT                   /note="putative"
FT                   /db_xref="GOA:P62141"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR006186"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="MGI:MGI:104871"
FT                   /db_xref="UniProtKB/Swiss-Prot:P62141"
FT                   /protein_id="BAE38902.1"
FT                   /translation="MADGELNVDSLITRLLEVRGCRPGKIVQMTEAEVRGLCIKSREIF
FT                   LSQPILLELEAPLKICGDIHGQYTDLLRLFEYGGFPPEANYLFLGDYVDRGKQSLETIC
FT                   LLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRFNIKLWKTFTDCFNCLPIAAI
FT                   VDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDTGLLCDLLWSDPDKDVQGWGENDRGV
FT                   FFTFGADVVSKFLNRHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGGM
FT                   MSVDETLMCSFQILKPSEKKAKYQYGGLNSGRPVTPPRTANPPKKR"
XX
SQ   Sequence 2975 BP; 811 A; 520 C; 660 G; 984 T; 0 other;
     gggatgaggt gcaggaggcg gtggcggctg ggtctgacgc ggcccggttc ctgacgcggc        60
     ccggttcctg ggggcctgct tgtttattta tttatttcca gtgggcgccg ccagcgtgtg       120
     cgcgcgctgt cgctgctcgg cggggagggg gtggggggag ggcccgcgcc cggggggagt       180
     tggagccggg gtcgaaacgc cgcgtgactc gtaggtgaga acgccgagcc gccgccgccg       240
     ccgagaagcc ctgttaacgc tttagggagg agagtctggt gccgacaaga tggcggacgg       300
     ggagctgaac gtggacagcc tcatcacccg cctgctggag gtacgaggat gtcgtccagg       360
     aaagattgta caaatgactg aagcagaagt ccgagggttg tgtatcaagt ctcgtgaaat       420
     ctttctcagc cagcctattc ttttggaatt ggaagcacca ctgaagattt gtggagacat       480
     tcatggacaa tatacagact tactaagatt atttgaatat ggaggttttc caccagaagc       540
     caactatctt ttcttaggag attatgtgga cagaggaaag cagtctttgg aaaccatctg       600
     tttgctattg gcttacaaaa tcaaataccc ggagaacttc tttcttctaa gaggaaacca       660
     tgagtgtgct agcatcaatc gcatttatgg attctacgat gagtgtaaac gaagatttaa       720
     tattaaattg tggaagacat tcactgattg ttttaactgt ctgcctatag ctgctattgt       780
     tgatgagaaa atcttctgtt gtcatggagg actgtcacca gacctacaat ctatggaaca       840
     gattcggaga attatgagac ccactgacgt acctgataca ggtttgcttt gtgacttact       900
     gtggtccgac ccagataagg atgtgcaagg ctggggagaa aatgaccgtg gtgttttttt       960
     tacttttgga gctgatgtag tcagtaaatt tctgaatcgt catgatttag acttgatttg      1020
     tcgagctcat caggtggtgg aagacggata tgaatttttt gctaaacgac agttggtaac      1080
     cttattttct gccccaaatt actgtggcga gtttgacaat gctggtggta tgatgagtgt      1140
     ggatgagact ttgatgtgtt cattccagat attgaaacca tctgaaaaga aagctaagta      1200
     ccagtatggt gggctgaatt ctggacgtcc tgtcactccg cctcgaacag ctaatccacc      1260
     gaagaaaagg tgaagacagg aattctagaa agagaaacca tcagatttgt taaggacata      1320
     cttcataata tataagtgtg cactgtaaaa ccatccagcc attcgacacc ctttatgatg      1380
     tcacaccttt aacttaagga gacggtaaag gatcttaaat ttttttctaa tagaaagatg      1440
     tgctacactg tattgtaata agtatactct gttataatat tcaacaaaat taaatccaaa      1500
     ttcaaaagta tccattaaag ttctatcttc tcatatcaca gtttttaaag ttgaaaagca      1560
     tcccagttaa actagccctg ttagtgaccc agatgaaagc atgaagatcc atctgtgtaa      1620
     tgtggtttta gtggtgcttg gttgtttcat tattttgagc ttgttttgtt ttgtttgttt      1680
     ttgctagaat aatggcatct acttttccta tttttcccta aacattttta aaagtgaaaa      1740
     tgggaagagc tttaaagaca ttcaccaact attcttttcc tttacttatc tacttaagta      1800
     actgttggat cttactaaga aaacttaccc ctcattacag taaaaaggaa ctttagaggt      1860
     cgataggttt taaaaatata caaactatct gatccattga ttttaatcaa acagtttgac      1920
     tgggcaaact ttgcagctga taatgagtat ttcgcttttt acaaaattgc cactgatttg      1980
     gatttgtgca ctctaatctt taatttattg atgctctatt gtgcagtagc atttcattta      2040
     agataaggct catatagtaa catccaaaac tagttggtaa tgtgattatg tggtactttg      2100
     gctttgggtt ctaattcgca cgaaacacct tttggcatgc ttaactttct ggtattaccc      2160
     tcacctgcat tggttttgtt ttttggggtt tttgttgttt gtttgttttt agattcacag      2220
     aacatgagaa tcctttttga caagccttgg atagctggct ctcttctttc cctctctcta      2280
     tgtgaaggat gtatttaaat gaacgctggt cagtgggaca tttgtcagct ctgaatattg      2340
     ggtgcttcac taataattgc catgtgaatg ttgttttgac tgtaaggcta tgtcactaaa      2400
     gatttttact ctgcgttttc ataatcaaag gtcatgatgt gtatagacat gctttgtagt      2460
     gaagtatagt agcaataatt tctgtatgtg atcaagagtt tattgcatta tttctttccc      2520
     tgttctcttt tttttttttt taagggttag cattaacaaa tgtcaaggag tagcaaagtc      2580
     aacaaagatt ttagaaggag gaggaactaa gagcatacac agacttatga ttctttggat      2640
     gtgacactta ttggatgtga ttctaaagtc ttttattgaa cattgtcaaa ttcgtacgct      2700
     tcataggatg gacataatgt ttatataatg cccttcttat gtgttaccat agatgtgtga      2760
     aaccttatag cgtccttgaa agtgttaaat tgagaactct gttaacattt tatggattga      2820
     cacattatat tactgcaagt aacatttgat tttcagcaca gtgcaaaagt tctttaaaat      2880
     gcatatgtct ttttttttct aattccattt tgtttaaagc acattttaaa tgtagttttc      2940
     tcatttagta aaagttgtct aattgataca acgcc                                 2975
//


spacer
spacer