spacer

EBI Dbfetch

ID   AK166168; SV 1; linear; mRNA; HTC; MUS; 2854 BP.
XX
AC   AK166168;
XX
DT   09-SEP-2005 (Rel. 85, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 10)
XX
DE   Mus musculus mammary gland RCB-0526 Jyg-MC(A) cDNA, RIKEN full-length
DE   enriched library, clone:G830002H24 product:protein phosphatase 1, catalytic
DE   subunit, beta isoform, full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2854
RA   Arakawa T., Carninci P., Fukuda S., Hashizume W., Hayashida K., Hori F.,
RA   Iida J., Imamura K., Imotani K., Itoh M., Kanagawa S., Kawai J., Kojima M.,
RA   Konno H., Murata M., Nakamura M., Ninomiya N., Nishiyori H., Nomura K.,
RA   Ohno M., Sakazume N., Sano H., Sasaki D., Shibata K., Shiraki T.,
RA   Tagami M., Tagami Y., Waki K., Watahiki A., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (14-APR-2004) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; 887e8bf43b312b76fd4220c7665f1cc9.
DR   Ensembl-Gn; ENSMUSG00000014956; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000015100; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000131300; mus_musculus.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=G830002H24
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2854
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="G830002H24"
FT                   /cell_line="RCB-0526 Jyg-MC(A)"
FT                   /tissue_type="mammary gland"
FT                   /db_xref="taxon:10090"
FT   CDS             305..1288
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="protein phosphatase 1, catalytic subunit, beta
FT                   isoform (MGD|MGI:104871 GB|NM_172707, evidence: BLASTN,
FT                   99%, match=2652)"
FT                   /note="putative"
FT                   /db_xref="GOA:P62141"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR006186"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="MGI:MGI:104871"
FT                   /db_xref="UniProtKB/Swiss-Prot:P62141"
FT                   /protein_id="BAE38608.1"
FT                   /translation="MADGELNVDSLITRLLEVRGCRPGKIVQMTEAEVRGLCIKSREIF
FT                   LSQPILLELEAPLKICGDIHGQYTDLLRLFEYGGFPPEANYLFLGDYVDRGKQSLETIC
FT                   LLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRFNIKLWKTFTDCFNCLPIAAI
FT                   VDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDTGLLCDLLWSDPDKDVQGWGENDRGV
FT                   SFTFGADVVSKFLNRHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGGM
FT                   MSVDETLMCSFQILKPSEKKAKYQYGGLNSGRPVTPPRTANPPKKR"
XX
SQ   Sequence 2854 BP; 768 A; 507 C; 654 G; 925 T; 0 other;
     gggtgccgag gaggaggtgg aggaggcggt ggcggctggg gtctgacgcg gcccggttcc        60
     tgacgcggcc cggttcctgg gggcctgctt gtttatttat ttatttccag tgggcgccgc       120
     cagcgtgtgc gcgcgctgtc gctgctcggc ggggaggggg tggggggagg gcccgcgccc       180
     ggggggagtt ggagccgggg tcgaaacgcc gcgtgactcg taggtgagaa cgccgagccg       240
     ccgccgccgc cgccgccgag aagctctgtt accgctttag ggaggagagt ctggtgccga       300
     caagatggcg gacggggagc tgaacgtgga cagcctcatc acccgcctgc tggaggtacg       360
     aggatgtcgt ccaggaaaga ttgtgcaaat gactgaagca gaagtccgag ggttgtgtat       420
     caagtctcgt gaaatctttc tcagccagcc tattcttttg gaattggaag caccactgaa       480
     gatttgtgga gacattcatg gacaatatac agacttacta agattatttg aatatggagg       540
     ttttccacca gaagccaact atcttttctt aggagattat gtggacagag gaaagcagtc       600
     tttggaaacc atctgtttgc tattggctta caaaatcaaa tacccggaga acttctttct       660
     tctaagagga aaccatgagt gtgctagcat caatcgcatt tatggattct acgatgagtg       720
     taaacgaaga tttaatatta aattgtggaa gacattcact gattgtttta actgtctgcc       780
     tatagctgct attgttgatg agaaaatctt ctgttgtcat ggaggactgt caccagacct       840
     acaatctatg gaacagattc ggagaattat gagacccact gacgtacctg atacaggttt       900
     gctttgtgac ttactgtggt ccgacccaga taaggatgtg caaggctggg gagaaaatga       960
     ccgtggtgtt tcttttactt ttggagctga tgtagtcagt aaatttctga atcgtcatga      1020
     tttagacttg atttgtcgag ctcatcaggt ggtggaagac ggatatgaat tttttgctaa      1080
     acgacagttg gtaaccttat tttctgcccc aaattactgt ggcgagtttg acaatgctgg      1140
     tggtatgatg agtgtggatg agactttgat gtgttcattc cagatattga aaccatctga      1200
     aaagaaagct aagtaccagt atggtgggct gaattctgga cgtcctgtca ctccgcctcg      1260
     aacagctaat ccaccgaaga aaaggtgaag acaggaattc tagaaagaga aaccatcaga      1320
     tttgttaagg acatacttca taatatataa gtgtgcactg taaaaccatc cagccattcg      1380
     acacccttta tgatgtcaca cctttaactt aaggagacgg taaaggatct taaatttttt      1440
     tctaatagaa agatgtgcta cactgtattg taataagtat actctgttat aatattcaac      1500
     aaaattaaat ccaaattcaa aagtatccat taaagttcta tcttctcata tcacagtttt      1560
     taaagttgaa aagcatccca gttaaaccta gccctgttag tgacccagat gaaagcatga      1620
     agatccatct gtgtaatgtg gttttagtgg tgcttggttg tttcattatt ttgagcttgt      1680
     tttgttttgt ttgtttttgc tagaataatg gcatctactt ttcctatttt tccctaaaca      1740
     tttttaaaag tgaaaatggg aagagcttta aagacattca ccaactattc ttttccttta      1800
     cttatctact taagtaactg ttggatctta ctaagaaaac ttacccctca ttacagtaaa      1860
     aaggaacttt agaggtcgat aggttttaaa aatatacaaa ctatctgatc cattgatttt      1920
     aatcaaacag tttgactggg caaactttgc agctgataat gagtatttcg ctttttacaa      1980
     aattgccact tatttggatt tgtgcactct aatctttaat ttattgatgc tctattgtgc      2040
     agtagcattt catttaagat aaggctcata tagtaatatc caaaactagt tggtaatgtg      2100
     attatgtggt accttggctt tgggttctaa ttcgcacgaa acaccttttg gcatgcttaa      2160
     ctttctggta ttaccctcac ctgcattggt tttgtttttt ggggtttttg ttgtttgttt      2220
     gtttttagat tcacagaaca tgagaatcct ttttgacaag ccttggatag ctggctctct      2280
     tctttccctc tctctatgtg aaggatgtat ttaaatgaac gctggtcagt gggacatttg      2340
     tcagctctga atattgggtg cttcactaat aattgccatg tggatgttgt tttgactgta      2400
     aggctatgtc actaaagatt tttactctgc gttttcataa tcaaaggtca tgatgtgtat      2460
     agacatgctt tgtagtgaag tatagtagca ataatttctg tatgtgatca agagtttatt      2520
     gcattatttc tttccctgtt ctcttttttt ttttttaagg gttagcatta acaaatgtca      2580
     aggagtagca aagtcaacaa agattttaga aggaggagga actaagagca tacacagact      2640
     tatgattctt tggatgtgac acttattgga tgtgattcta aagtctttta ttgaacattg      2700
     tcaaattcgt acgcttcata ggatggacat aatgtttata taatgccctt cttatgtgtt      2760
     accatagatg tgtgaaacct tatagcgtcc ttgaaagtgt taaattgaga actctgttaa      2820
     cattttatgg attgacacat tatattactg caag                                  2854
//


spacer
spacer