Dbfetch

ID   AK165860; SV 1; linear; mRNA; HTC; MUS; 1276 BP.
XX
AC   AK165860;
XX
DT   09-SEP-2005 (Rel. 85, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 10)
XX
DE   Mus musculus lung RCB-0558 LLC cDNA, RIKEN full-length enriched library,
DE   clone:G730008D22 product:nucleophosmin 1, full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1276
RA   Arakawa T., Carninci P., Fukuda S., Hashizume W., Hayashida K., Hori F.,
RA   Iida J., Imamura K., Imotani K., Itoh M., Kanagawa S., Kawai J., Kojima M.,
RA   Konno H., Murata M., Nakamura M., Ninomiya N., Nishiyori H., Nomura K.,
RA   Ohno M., Sakazume N., Sano H., Sasaki D., Shibata K., Shiraki T.,
RA   Tagami M., Tagami Y., Waki K., Watahiki A., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (14-APR-2004) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science, e1252229 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science, e1252229 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; 80ae41e99170033f65083ddce0494b0e.
DR   Ensembl-Gn; ENSMUSG00000057113; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000075641; mus_musculus.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=G730008D22
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1276
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="G730008D22"
FT                   /cell_line="RCB-0558 LLC"
FT                   /tissue_type="lung"
FT                   /db_xref="taxon:10090"
FT   CDS             100..978
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="nucleophosmin 1 (MGD|MGI:106184 GB|AK028253,
FT                   evidence: BLASTN, 100%, match=1274)"
FT                   /note="putative"
FT                   /db_xref="GOA:Q5SQB7"
FT                   /db_xref="InterPro:IPR004301"
FT                   /db_xref="InterPro:IPR024057"
FT                   /db_xref="InterPro:IPR032569"
FT                   /db_xref="MGI:MGI:106184"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SQB7"
FT                   /protein_id="BAE38420.1"
FT                   /translation="MEDSMDMDMSPLRPQNYLFGCELKADKDYHFKVDNDENEHQLSLR
FT                   TVSLGAGAKDELHIVEAEAMNYEGSPIKVTLATLKMSVQPTVSLGGFEITPPVVLRLKC
FT                   GSGPVHISGQHLVAVEEDAESEDEDEEDVKLLGMSGKRSAPGGGNKVPQKKVKLDEDDE
FT                   DDDEDDEDDEDDDDDDFDEEETEEKVPVKKSVRDTPAKNAQKSNQNGKDLKPSTPRSKG
FT                   QESFKKQEKTPKTPKGPSSVEDIKAKMQASIEKGGSLPKVEAKFINYVKNCFRMTDQEA
FT                   IQDLWQWRKSL"
FT   regulatory      1257..1262
FT                   /note="putative"
FT                   /regulatory_class="polyA_signal_sequence"
FT   polyA_site      1276
FT                   /note="putative"
XX
SQ   Sequence 1276 BP; 417 A; 221 C; 310 G; 328 T; 0 other;
     gtccttggcg tgattccgtc ctgcgcgtct gttctgtgga acaggaggca gttgttttcc        60
     gtccggcttc tcccacaccg aagtgcgcgc ctccacctca tggaagactc gatggatatg       120
     gacatgagtc ctcttaggcc tcagaactac cttttcggct gtgaactaaa ggctgacaaa       180
     gactatcact ttaaagtgga taatgatgaa aatgagcacc agttgtcatt aagaacggtc       240
     agtttaggag caggggcaaa agatgagtta cacatcgtag aggcagaagc aatgaactat       300
     gaaggcagtc caattaaagt aacactggca actttgaaaa tgtctgtaca accaacagtt       360
     tccctagggg gctttgaaat tacaccacct gtggtcttac ggttgaagtg tggttcaggg       420
     cctgtgcaca ttagtggaca gcatctagta gctgtagagg aagatgcaga gtctgaagat       480
     gaagatgagg aggacgtaaa actcttaggc atgtctggaa agcgatctgc tcctggaggt       540
     ggtaacaagg ttccacagaa aaaagtaaaa cttgatgaag atgatgagga cgatgatgag       600
     gacgatgagg atgatgagga tgatgatgat gatgattttg atgaagagga aactgaagaa       660
     aaggtcccag tgaagaaatc tgtacgagat accccagcca aaaatgcaca aaaatcaaac       720
     caaaatggaa aagacttaaa accatcaaca ccgagatcaa agggtcaaga gtccttcaaa       780
     aaacaggaaa agactcctaa aacaccaaaa ggacctagtt ctgtagaaga cattaaggca       840
     aaaatgcaag caagtataga aaaaggcggt tctcttccca aagtggaagc caagttcatt       900
     aattatgtga agaattgttt ccggatgact gaccaggagg ctattcaaga tctctggcag       960
     tggaggaaat ctctttaaga aaagggttta aacagtttga aatattctgt cttcatttct      1020
     gtaatagtta atatctggct gtccttttta taatgcaaag tgagaacttt ccctactgtg      1080
     tttgataaat gttgtccagg ttcacttgcc aagaatgtgt tgtctaaaat gcctgtttag      1140
     ttttcaagga tggaactcca ccctttactt ggttttaagt atgtatggaa tgttatgata      1200
     ggacatagta atagtggtca gatgtggaaa tggtagggag acaaatatac atgtgaaata      1260
     aactcagtat tttaat                                                      1276
//