spacer

EBI Dbfetch

ID   AK165230; SV 1; linear; mRNA; HTC; MUS; 4104 BP.
XX
AC   AK165230;
XX
DT   09-SEP-2005 (Rel. 85, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 10)
XX
DE   Mus musculus 6 days neonate spleen cDNA, RIKEN full-length enriched
DE   library, clone:F420013G16 product:phosphatidylinositol 3-kinase, catalytic,
DE   beta polypeptide, full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-4104
RA   Arakawa T., Carninci P., Fukuda S., Hashizume W., Hayashida K., Hori F.,
RA   Iida J., Imamura K., Imotani K., Itoh M., Kanagawa S., Kawai J., Kojima M.,
RA   Konno H., Murata M., Nakamura M., Ninomiya N., Nishiyori H., Nomura K.,
RA   Ohno M., Sakazume N., Sano H., Sasaki D., Shibata K., Shiraki T.,
RA   Tagami M., Tagami Y., Waki K., Watahiki A., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (14-APR-2004) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; 586a35b2e057f08daea8378539953784.
DR   Ensembl-Gn; ENSMUSG00000032462; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000035037; mus_musculus.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=F420013G16
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..4104
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /dev_stage="6 days neonate"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="F420013G16"
FT                   /tissue_type="spleen"
FT                   /db_xref="taxon:10090"
FT   CDS             <1..1003
FT                   /codon_start=2
FT                   /transl_table=1
FT                   /note="phosphatidylinositol 3-kinase, catalytic, beta
FT                   polypeptide (MGD|MGI:1922019 GB|NM_029094, evidence:
FT                   BLASTN, 100%, match=2314)"
FT                   /note="putative"
FT                   /note="start codon is not identified"
FT                   /db_xref="GOA:Q3TNJ8"
FT                   /db_xref="InterPro:IPR000403"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR015433"
FT                   /db_xref="InterPro:IPR018936"
FT                   /db_xref="MGI:MGI:1922019"
FT                   /db_xref="UniProtKB/TrEMBL:Q3TNJ8"
FT                   /protein_id="BAE38090.1"
FT                   /translation="GKEAMHTCLKQSAYREALSDLQSPLNPCVILSELYVEKCKYMDSK
FT                   MKPLWLVYSSRAFGEDSVGVIFKNGDDLRQDMLTLQMLRLMDLLWKEAGLDLRMLPYGC
FT                   LATGDRSGLIEVVSTSETIADIQLNSSNVAATAAFNKDALLNWLKEYNSGDDLDRAIEE
FT                   FTLSCAGYCVASYVLGIGDRHSDNIMVKKTGQLFHIDFGHILGNFKSKFGIKRERVPFI
FT                   LTYDFIHVIQQGKTGNTEKFGRFRQCCEDAYLILRRHGNLFITLFALMLTAGLPELTSV
FT                   KDIQYLKDSLALGKSEEEALKQFKQKFDEALRESWTTKVNWMAHTVRKDYRS"
XX
SQ   Sequence 4104 BP; 1042 A; 931 C; 950 G; 1181 T; 0 other;
     gggaaaggag gccatgcaca cgtgcctgaa acagagtgct taccgggagg cgctctctga        60
     cctgcagtcg ccgctgaacc cctgcgtcat cctctcagag ctctatgttg aaaagtgcaa       120
     atacatggac tccaagatga agcccctgtg gctggtctac agcagcagag cctttggaga       180
     ggactcggtt ggagtgatct ttaaaaatgg tgacgatttg cggcaggaca tgctgacgct       240
     gcagatgttg cgcctgatgg atctgctttg gaaagaagct ggcttggacc tgcggatgct       300
     cccctatggc tgcttagcaa caggagatcg ctctggcctc attgaggttg tgagcacctc       360
     tgagacaatc gctgacattc agctgaacag tagtaacgtg gctgccacgg cagccttcaa       420
     caaagacgca ctcctgaact ggctcaagga gtacaactct ggggatgacc tggaccgagc       480
     gattgaggag tttaccttgt cctgtgctgg ctactgtgta gcctcttatg tcctcggcat       540
     tggtgacagg cacagtgaca acatcatggt gaagaaaacc ggccagctct tccacataga       600
     ttttgggcat attcttggaa atttcaaatc taaatttggc attaaaaggg agcgagtacc       660
     ttttattctt acttatgact tcattcatgt cattcaacaa ggaaaaacgg gaaacactga       720
     aaaatttggc agattccgcc agtgctgtga agatgcgtat ctgattttac ggcggcatgg       780
     gaatctcttc atcaccctgt ttgccctgat gttgactgca gggctgcctg agctcacatc       840
     ggtcaaagat atacagtatc ttaaggactc gcttgcctta gggaagagcg aggaggaagc       900
     actgaagcag ttcaagcaga agtttgacga ggccctcagg gaaagctgga ctactaaagt       960
     gaactggatg gctcacacag tacggaaaga ctacaggtcc tagcgtccgc cctactctgc      1020
     cgcacttgcc tgttcgtttc ctttccattt tgcacttgca ctattgaaca tgaccctgcc      1080
     agaaatgcaa agggaatgaa atcctgaagc tcagagtgaa gttcaaacca cggcgtcccg      1140
     cagagcctag tctgaaccac cccatgccca ccctgtgttc ccgagcgctt ccaggactca      1200
     tcgtgagcag cagcatggag gccccttcct gctgaccttg cacgcgaggg atgctactag      1260
     ggactgctgg ggatcttttc tttctttcct tcagtatttg gtactttacc agagaggtgt      1320
     acatacttct tttcagtgtt gtgaccaagt gctgcgactc agccaacaac ttaccacatt      1380
     cggggctggg agctgttcta agaaagggac ctccctctcc tttttaaatt ggtgagccac      1440
     aaattacatt gattatgttg aacttattat tcttcaaaga aaatatttta aacctgtgaa      1500
     aactcactaa ttttgttaat atttatcatg atggcatcat ttcagccaga ctcgctgaga      1560
     atctattggt ggggcaaata taatatatat ataatatata tatatatata tgctgcatat      1620
     atatttataa aatttctagt gggagttcta tataaaaaga tgtttctttg gtattcttca      1680
     gcctgtgttt tcaagtttta cagaagcaga gcttttccct aagttcctct tcggttcact      1740
     gtagatccag ttcttccagc cgcttcagca ctgaggcgcc atgaatgcgg tttctctgtg      1800
     tagctctgag agttcgtttc atagaacaca acacttgagc agatgcatcc aaggaggcga      1860
     gcaaatgaaa aggaatctat ttatggaata aactcgaaac ctaaatttca gtattttagt      1920
     aatatgccag ctgttcttaa tgtatttatt aaaatgtata acaatgtgat ttttcaatgg      1980
     tattagttca aattgacgtg gattcatgcc acatggaaat ctttaattta tttgttgagg      2040
     taccatatag ccagggtgct aggtgatgag tggtgttagc atgtgcaata ggaactactg      2100
     gtttgctgtg taaatggatg tcaggatcca gcaaaactac tgctttcttc tccaaagaca      2160
     tgtgggagcc ttcaatcctc agtggcatgg gaaacagctg agtacttgcc ccgtgacttc      2220
     agttttctat aggaatttta ttaaagagtg tttaattttg ttgtccttct taatgttctc      2280
     agtcaaataa atgggtggtt tcatctgttt ggggacatgt gggtgtcttc tttttgggaa      2340
     gcacagtctt tgcaacctgc tcccactggg actctccgaa atggccacgt cagtggacaa      2400
     accagcctta ggagtgggct tgggctcagg gcctctgccc ggcttcccct tgctttcttg      2460
     ttccacatgg acaacctggg aggcctctta gaccaggagg attcaagcct aagaggagga      2520
     gatgtttctg acagtttgct gttacaacct catctcccct gactctgctg cactacatgt      2580
     gtgcatgtgc acatgcacac gggaaagcca gggcagtgtg gctcagtagc tagacactga      2640
     cagtgctcca tccatacttg ctgaattgct tgtctcggtc tgagaagatg gaaggcagaa      2700
     agctaactgc aatctggagt gaattaacac tctaggctgt actaacatct acttgaacaa      2760
     agactgatta gccgccacct tgactttgag caagctatat tttatatctt cttaaatgcc      2820
     aagcttgttt tgcagcacat tttctctctc tggcccccag ccaaaggccc agatgccctc      2880
     caggttggct ttgagacctt ggtgttagta tttggaggat gtcagactag agttaacaca      2940
     gatccccagg cagcacagat ggaggatcgt cagatcacat gtggacggtg atcactcttt      3000
     gttcctgcgt gcatgtgtta actatatctc atcgtaactg actcagatta gtcagatatg      3060
     agcccgagtg ctgtgtttct gtgcctctct aaaattagaa cttctgccca gaggcaccct      3120
     aaggatacca ctcattgtcc tgtggttcgg tgggtgctcc taaaagaagt gtcaggtctt      3180
     cagcatgtgt tttatacatc tgccttgacc cccttggggg cgtaaagcca cacacttgtg      3240
     ctgcagcctc tgccagtggg ttacttggca ttcttggcaa atgcctctat aagattaggt      3300
     tgaaggcagg cctgtagggc atcttcttag tgattggtga ttggtgtgga agggcccaga      3360
     ccttaggggt ggttccaccg tgggatgata gtcctaggta gtataagaga gtaaactgag      3420
     caagaaacat tcctccatgg cctcttcagt tcctgcctcc gggttcctgc cctgtatatt      3480
     cctggcctgt aatgtggaac tgtaagccga aataaactct ttcctcccca agttccaagg      3540
     tatgtggggg taccaccaac tgaagttgat gtaatataat ttcattacct acttaataag      3600
     caggctggaa tagaccgaag caattttaga ttttagagtg gagaagccat ccaatctggg      3660
     aggataccag ttctctaatc tccaggtttc tctgaagcaa tatcttattt acaatatctt      3720
     cgagcaccta cctcaagact ggctgatccc cacttcccca cgtcttcctt ccgtgttacc      3780
     ttccacttga gtaagaaaac accacggtct tcagcagtat gacagtgaat gacttcgatc      3840
     tttttctaat tcataaaatg tgatgaagta aagatttaaa ttccaaaatg ctacatgcct      3900
     gcaccaatag ctgactgact gtgcgcctgc accaatagca ggtcattccc cagtccatca      3960
     tatctcccat ctgtttgtgg gcttatctta agtcaacaga attctaccaa gttaaatttg      4020
     agtgtggctc tgcccttggt ctttgaataa acatgttctc catgtaaatt tgttgtgtag      4080
     ccagtattac agctgagtta atct                                             4104
//


spacer
spacer