spacer

EBI Dbfetch

ID   AK165080; SV 1; linear; mRNA; HTC; MUS; 2675 BP.
XX
AC   AK165080;
XX
DT   09-SEP-2005 (Rel. 85, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 10)
XX
DE   Mus musculus 2 days pregnant adult female ovary cDNA, RIKEN full-length
DE   enriched library, clone:E330001F10 product:solute carrier family 12
DE   (potassium/chloride transporters), member 8, full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2675
RA   Arakawa T., Carninci P., Fukuda S., Hashizume W., Hayashida K., Hori F.,
RA   Iida J., Imamura K., Imotani K., Itoh M., Kanagawa S., Kawai J., Kojima M.,
RA   Konno H., Murata M., Nakamura M., Ninomiya N., Nishiyori H., Nomura K.,
RA   Ohno M., Sakazume N., Sano H., Sasaki D., Shibata K., Shiraki T.,
RA   Tagami M., Tagami Y., Waki K., Watahiki A., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (14-APR-2004) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; 66387907b4c43c3a223bfbb370377dcc.
DR   Ensembl-Gn; ENSMUSG00000035506; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000059056; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000119173; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000121925; mus_musculus.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=E330001F10
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2675
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /sex="female"
FT                   /dev_stage="2 days pregnant adult"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="E330001F10"
FT                   /tissue_type="ovary"
FT                   /db_xref="taxon:10090"
FT   CDS             393..1625
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="putative"
FT                   /note="solute carrier family 12 (potassium/chloride
FT                   transporters), member 8 (MGD|MGI:2443672 GB|BC030926,
FT                   evidence: BLASTN, 100%, match=1562)"
FT                   /db_xref="GOA:Q8VI23"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="MGI:MGI:2443672"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8VI23"
FT                   /protein_id="BAE38029.1"
FT                   /translation="MAGFNMGGDLRDPADSVPLGSLAAVGVSWFLYIIFAFLLGAVCTR
FT                   EALRSDFLIAEKKGPNKTPVAAICLTSLVTMAFVLVGQVNVLAPVVTINFMLTYIMVDY
FT                   SYFALSMAHCGLAPSPEPVPRQGPDTLHCSEHLLQDRAPSYGSDVPARSLSEGTLLEFT
FT                   KDMDQFLQPIEELESRQLGSREGNNPKNQKRKGKKGAKQTLQDSFLLDPGSPLSFPTRT
FT                   SERLSVAFCGEQESYQKQQTSRSESHDHLVPDLRNQPRVNREDFFLKCRLQEQEIQRRP
FT                   SVFYACMCNPWVSLLGALASLLIMFVIQWLYTLASMGVAALVYFYIGQASPGLYLGSAS
FT                   NFSFFQWMKSFLVPSCRSLRSAQEQIILAPSPAKVDMAMTQLTQDNADFATRDRYHHSS
FT                   FLSREQLMPPY"
FT   polyA_signal    2651..2656
FT                   /note="putative"
FT   polyA_site      2675
FT                   /note="putative"
XX
SQ   Sequence 2675 BP; 664 A; 696 C; 602 G; 713 T; 0 other;
     gtcatttcat attcaaaatc ttacatatct gcatctgctt taaagtttag gctaaatctt        60
     tacttgggtt ctactgtcga tcacccagat ggtaagcagt aaaccctact gtttctctgg       120
     aggagagact gcatggtgtc tggggctatc cctgccaccc ttgcttgagc cttggcattt       180
     gcaaggcctg gtctgaggct gtcttttcca gcagcatctg tacagctaag gagatggagg       240
     actggttctg tctccgagga gaaaagggat aaagattcta caagaacaac ttagctgacc       300
     agtttgtaag ccaatgtggg gcaggaacat ggtttggaaa tgaggaagaa gggagggaga       360
     gacagcccaa gtctttggaa acttcaggag tcatggctgg cttcaacatg ggaggagacc       420
     tgagagaccc tgctgacagt gtccccttag gctccctagc agctgttggc gtctcgtggt       480
     ttctctacat catctttgcc ttcctgcttg gtgccgtctg tacccgagag gccctccgct       540
     ctgacttcct gatagctgaa aagaaagggc caaataaaac accggtagca gccatctgcc       600
     tgaccagctt ggtgaccatg gcctttgtcc tggtgggtca ggtgaatgtt ctggcgcccg       660
     ttgtcaccat caatttcatg ctgacctaca tcatggtgga ctactcttac ttcgccctct       720
     ccatggctca ctgtggcctc gccccatctc ctgagcccgt ccccagacaa ggcccagata       780
     ctctgcactg ctctgagcac ctgctccagg acagggctcc cagctacggc tctgatgtcc       840
     ctgccagaag cctctctgag ggcaccctgc tggagttcac caaggacatg gatcagttcc       900
     tccagccaat agaggaactg gagagtcgtc agcttgggtc aagagaagga aacaacccaa       960
     agaatcagaa gcgcaagggt aagaaaggcg ccaagcaaac cctacaagat agcttcctct      1020
     tggaccctgg gtctcctttg tcctttccta cgaggacttc tgagaggttg tctgttgcct      1080
     tctgtgggga gcaagagtcc tatcagaagc agcagacttc taggagtgaa tcacatgacc      1140
     atcttgttcc tgatctacgc aaccagccta gagtgaacag agaagatttc tttctgaaat      1200
     gcagacttca ggaacaagag atccagagaa gaccaagtgt tttctatgct tgcatgtgta      1260
     acccctgggt ctccctgtta ggggctcttg catccctgct catcatgttt gtgatccagt      1320
     ggctctatac cctagctagt atgggtgttg ctgcccttgt gtatttctac attggccagg      1380
     caagtccagg cctttacctc ggatcagcat caaacttcag ctttttccaa tggatgaagt      1440
     ccttcttggt cccctcctgc aggagcctga ggtccgccca ggagcaaatc atcttggcgc      1500
     catcaccagc caaggttgac atggcaatga ctcagcttac ccaggacaat gcagacttcg      1560
     ccacccgaga tcgttaccac cactcctcct tcctgagccg ggagcagttg atgcctccct      1620
     actaggacct cgctggaccc cacctttcta gaagccgctg tggagatggg ggacccaagc      1680
     ctcagaacct ttggaagttg cttctaccaa taagaaaacc caagactggt cttcccacca      1740
     cagccttgga cgctggaaat cacattccgg tctgaaatgg catgtctagc cagatactag      1800
     gtatgactat ggcttccacg tgtgcccaac ctgaagagtc cacaggcacc aggatgatca      1860
     ggtgacacca agacaaccaa atgtggagaa tcaaaacgag atttcttatt ctaaggggcc      1920
     aaaataaaca cttcttttta attttattgt tttatttttt attattttta aagaattata      1980
     tatatataca tatactgtag ctattttcag acagaaaata gcatcaccag aagagggcat      2040
     cggatcccat tacagatggt tgtgagccac catgtggttg ctgggaattg aactcaggat      2100
     ctctggaaga acagtcagtg ctcctaactg ctgagccatc tctccagcac cctcccctgt      2160
     tttatttatt ttgtaatgta tactaactac actcacatgg ttcccaagcc acagagtata      2220
     gaaaccccct tctccctgtt tctcatctgt ttggtgtccg tcccccatca caggggcaac      2280
     cacttctcat gcaaacatca gccacctctt tacagacccc tcccatctgc aaatgcagct      2340
     ctgtttacaa tgcactacat cccgctcttc tcccttaatc tgccatagaa gcatttccat      2400
     gaagatgctt acacagtttc ctccttatgt ctctatgtct gaatgtgcct taatttatat      2460
     actcagcctc acgaggacgg catttagctt cattctgata ttttgctatt acagccgctt      2520
     ctgcaaagag tcactgtgtt tgtgtgcaca gtcgtgaagg atacctgaag ataaattctc      2580
     agaaggagaa ttacagggtg actggggatg tacatttgta agctgttact gtttggagaa      2640
     atgcttttta attaaaaagt caatcaaata ccacg                                 2675
//


spacer
spacer