spacer

EBI Dbfetch

ID   AK164964; SV 1; linear; mRNA; HTC; MUS; 4796 BP.
XX
AC   AK164964;
XX
DT   09-SEP-2005 (Rel. 85, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 10)
XX
DE   Mus musculus 0 day neonate eyeball cDNA, RIKEN full-length enriched
DE   library, clone:E130009K08 product:protein phosphatase 1F (PP2C domain
DE   containing), full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-4796
RA   Arakawa T., Carninci P., Fukuda S., Hashizume W., Hayashida K., Hori F.,
RA   Iida J., Imamura K., Imotani K., Itoh M., Kanagawa S., Kawai J., Kojima M.,
RA   Konno H., Murata M., Nakamura M., Ninomiya N., Nishiyori H., Nomura K.,
RA   Ohno M., Sakazume N., Sano H., Sasaki D., Shibata K., Shiraki T.,
RA   Tagami M., Tagami Y., Waki K., Watahiki A., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (14-APR-2004) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; bc9ca5d41ad51aba3f9d9ce5206ac1c0.
DR   Ensembl-Gn; ENSMUSG00000026181; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000027373; mus_musculus.
DR   EuropePMC; PMC3946626; 24608696.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=E130009K08
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..4796
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /dev_stage="0 day neonate"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="E130009K08"
FT                   /tissue_type="eyeball"
FT                   /db_xref="taxon:10090"
FT   CDS             103..1461
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="protein phosphatase 1F (PP2C domain containing)
FT                   (MGD|MGI:1918464 GB|NM_176833, evidence: BLASTN, 99%,
FT                   match=4764)"
FT                   /note="putative"
FT                   /db_xref="GOA:Q8CGA0"
FT                   /db_xref="InterPro:IPR000222"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR015655"
FT                   /db_xref="MGI:MGI:1918464"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8CGA0"
FT                   /protein_id="BAE37981.1"
FT                   /translation="MASGAAQNSSQMACDSEIPGFLDAFLQDFPAPLSLESPLPWKVPG
FT                   TVLSQEEVEAELIELALGFLGSRNAPPSFAVAVTHEAISQLLQTDLSEFKRLPEQEEEE
FT                   EEEEEEKALVTLLDAKGLARSFFNCLWKVCSQWQKQVPLTAQAPQWQWLVSIHAIRNTR
FT                   RKMEDRHVSLPAFNHLFGLSDSVHRAYFAVFDGHGGVDAARYASVHVHTNASHQPELRT
FT                   NPAAALKEAFRLTDEMFLQKAKRERLQSGTTGVCALIAGAALHVAWLGDSQVILVQQGR
FT                   VVKLMEPHKPERQDEKARIEALGGFVSLMDCWRVNGTLAVSRAIGDVFQKPYVSGEADA
FT                   ASRELTGSEDYLLLACDGFFDVVPHHEVTGLVHGHLLRHKGNGMRIAEELVAVARDRGS
FT                   HDNITVMVVFLREPLELLEGGVQGTGDAQADVGSQDLSTGLSELEISNTSQRS"
FT   polyA_signal    4781..4786
FT                   /note="putative"
FT   polyA_site      4796
FT                   /note="putative"
XX
SQ   Sequence 4796 BP; 1104 A; 1211 C; 1334 G; 1147 T; 0 other;
     agagcagctc gtggggagca ctgcggcagg ctggcagagt gaagacttga ctggagactg        60
     tctcacccca gcctagctgc aaacccccgg aatgcactgg gcatggcctc tggagccgca       120
     cagaacagca gccagatggc ctgtgacagt gagatcccag gcttcctgga cgcattcctc       180
     caagacttcc cagccccact gagcctggag agccctttgc catggaaggt cccagggaca       240
     gtcctgagcc aggaagaagt ggaggctgag ctgattgagc tggcattggg cttcctgggc       300
     agcaggaacg ctcccccatc gtttgctgtg gctgtgaccc acgaggcaat ttcccagctg       360
     ctgcagacag acctttctga atttaagagg ttgcctgaac aagaggagga ggaggaagag       420
     gaggaagaag agaaagccct cgtgacctta ctagatgcca aaggcctggc acggagcttc       480
     ttcaactgcc tttggaaagt atgtagccag tggcagaagc aggtgccgtt gactgcccag       540
     gcccctcagt ggcagtggct ggtctctatc catgccatcc ggaacacacg acgcaagatg       600
     gaggaccgac acgtgtccct tcctgctttc aaccatctct tcggcttgtc tgactctgtg       660
     caccgtgcct actttgctgt gtttgatggt catggaggcg tggatgcagc aaggtatgcc       720
     tctgtccacg tgcataccaa tgcttctcac cagccagagc tgcgcacaaa ccctgcagca       780
     gctctcaaag aagccttccg gctcaccgat gagatgtttc tccagaaagc caagcgagag       840
     cgactgcaga gcggtaccac gggtgtgtgt gcactcatcg cgggagcagc cctgcatgtt       900
     gcctggcttg gagactccca ggtcatcctg gtacagcaag gacgggtagt gaagctgatg       960
     gagccgcaca aaccggagcg acaggatgag aaagcacgaa ttgaagccct gggtggcttt      1020
     gtttctctca tggactgttg gagagtcaac gggaccctgg cagtgtctag agccattggg      1080
     gatgtcttcc agaagcccta tgtgtctggg gaggccgatg cagcatccag agagctaacg      1140
     ggctcagagg actacctgtt gcttgcttgt gatggtttct tcgatgttgt cccccaccat      1200
     gaagtcacgg gtctcgtcca tggccacttg ctcaggcaca agggcaatgg gatgcgtatt      1260
     gctgaggagc tggtggctgt ggcccgtgac cggggctccc atgacaacat tacagtcatg      1320
     gtggtcttcc ttagggagcc cctggagctg ctagagggtg gagtccaggg gacaggggat      1380
     gcccaggcag atgtaggaag ccaggacttg tccactggcc tctcagaact tgagatcagt      1440
     aatacctcac agagaagcta agtggtccag gcctccaggc cccatccgga ctctccctct      1500
     gccctcgtga tcctcccctt caaagacctt agatccaaaa ggtatagtgg gcaggggtgc      1560
     acactctcac agcattcctt tagcacccca gcccttcatg ttgcctacca cagcctgtcc      1620
     tcatggctgc agaactgcag taggcagcta gtggatctca gaaggaaaca taggaaaatg      1680
     gcctcaccga agagcagatg gctgaggtga tcagggccgg acaggtctgg gaacagaaac      1740
     cacaggcacc tgctggtagc ctaaccaaaa acacaggtca ggtcttggag gaccctcaca      1800
     cagatcctgg aatgagatct gcagccaggt gtccagccca ggcttgtggc ttctcattgt      1860
     acccaaggct gggagggttt ggtctgtact aacacacaag ctcgcagtcc tgcttgactg      1920
     ctggcttccc aaagaggaga cattggtctt gctgggaggc acagcaggag agtgacccac      1980
     tgccactgca ctctaactga gtactaaggc cactagggct ttctagacct cgctttcccc      2040
     ttgagcttcc tggggaggtg aagtgaggtg tgtgtgtgtg ggtgtgtctt tgtgtgctta      2100
     gatttattgc agggaaaggt ctaatccaga atcagtattc aggctttgtc atgttgtatc      2160
     agtgccaagg tgaccctcaa ggtcatgtaa cttaagcaaa gcttagcatt tattttattc      2220
     ctgaaaactt aagtatttta cttttttgtg tgttcgtgga gacatttgca gtattaatga      2280
     ttttattttt cctaaatcgg gatggaaaca aacttttcca ggttatgtta ataagccact      2340
     taagtgcctt aaacagcttt ggtgtagatg agaattgctg ggtccgtcat ggatcctgat      2400
     aggcagacgt gttgaggttc tcaaagaggc tgcatttgtt gtgggaaggc acactttcag      2460
     ccagcactct ttctgggaaa gtccttttgt gcgtctgggc acctcagaac ttccttgaag      2520
     tgatgggtaa aggctgtgac tatgggcacc tggggtgaca ctggcctcct tgtccacctt      2580
     ggagtctggc tggttcccag ctgagagaac cttactgctc ttggctagaa gattgacaca      2640
     ctcaatctct cttgaaactc tcttaagtgt gtttgcagtt atgttgattg agttgttgaa      2700
     gacagtgctt aggtgaggaa cttgggcaag cccagcagtc caccatcttt ctcctgtgac      2760
     ttgtgtccta acctgctaga ctctgtcctg acctgagcag catgaaagac ctccacatcc      2820
     ctagagcagt gatggataca gtcaggcaag gaaaccaagt gagggttggg ggggatacca      2880
     agaatagaag gactaggagg ccctcaacaa gggccaagcg agtcaaggct gctctctgca      2940
     gacactggca ggtccagaga ataatggtgg cttagcagag gctcagggaa ggatcagtag      3000
     gaagaagggt ggctgtgagg taggtcccca tgaaggagac atagttcacc tgtagagtga      3060
     aagccctagc aagacttgca gagctttgtt cattgcacct aagccctctt tgaaaagaag      3120
     caagggagct catacttatt cctctgaggc aagttcactt ccagcagtag gagagcgagc      3180
     cagccaaatg cagctgggca cccacctgta tgcttgccat ttacccattc ccacagcagg      3240
     gatggaagag ctggggccat gtagttgatt ccttgatcaa gtctcctgat aggaacgtga      3300
     tcactcagat ggctgcccac ctaatagcta ggtattgctt aacttgaagg cctgctgcct      3360
     tccggggggg ggggggtgtc agaatccagc atcctcagtg ccatctcaac acagggtgtg      3420
     gttgttggtc cagcctgcct gtagcagtga ccttcataga gggagataaa ttgattttgg      3480
     ttttctccca tttttgctaa cctgatcatt gctggtaaga gtggaatttg ggcctccttg      3540
     gtggtctgga ttcatactcg catgtaaaga tgtgccaaat atcaaggcct cagtgtaaag      3600
     ggaagcccct ttcccaggct tgtctgagtg cctcccccac ccttccccct gtctggcaat      3660
     ggtctgggac caacatcagg cactgctcca tcctgatcta gtggccaagg aagaccacat      3720
     tctcctactg ttgagggctg gccttgagcg agttcctagg tacagagaac tctttttgtc      3780
     tggactggag ttgccagtac caagcctaca agacttgttg gccacctcct cctcagagtc      3840
     tcttcccaaa agaatcccct agccaggata atgggtggct tagtagaggc tcagggaagg      3900
     aacagggaga agggtggctg tgagctcaag tccccctctt tgccaccatc acattgtgtg      3960
     agcggaacca gtcactgcac ctctcaggcc tcagggaaag gcatggaggg catgcatagc      4020
     attaccagga gctgccagag cacgggagcc catcctccac cagcagcaga gaggggttaa      4080
     gtattattag tgtctattct taaaattaag tgggctggaa cagagctgag ttacaggcgc      4140
     cagtgtctta cacagataca aaagctgaag ccgtcagcct gcctttgcag gtacagctgc      4200
     ctcccaacca aggcctggag gcgttaagag gtgggagggc acaagcaggc tttcaggagt      4260
     gttgaagcaa gggatctgca gcatagcttt gggcgtctcc agaactcatg gtgagggagg      4320
     caccaacacc tagaggtctt aaaagccctg cattcaccat gatctgtctg cccctgccct      4380
     tttgggttct tctgcatgca gtgcccccct ctcctgatgc taagttttgg catgggtgtc      4440
     ctggctacct caactgtatt ctcaaggcca ggaggatggc tctggccata cttacggaag      4500
     ccaggccaat ttgtgtgaag caagctgggc ttctggtttg attcagcttc tgtagcctcc      4560
     agggaccatc ctctggagtc ttgtgctttc actggactct tcagcttcac caaacacacc      4620
     aagctttgcc atttacatgc catgtgggcc ttgccaaggg ttatttcagg ggtcttcctg      4680
     ggagtcttgt tctaagacac cgtgtttctt tagtcttagg gacaactccc aaggtgatga      4740
     gctcatagga cgtcttccca tggggccctg tactggtgtc aataaaccat atattc          4796
//


spacer
spacer