spacer

EBI Dbfetch

ID   AK164900; SV 1; linear; mRNA; HTC; MUS; 3695 BP.
XX
AC   AK164900;
XX
DT   09-SEP-2005 (Rel. 85, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 11)
XX
DE   Mus musculus 0 day neonate lung cDNA, RIKEN full-length enriched library,
DE   clone:E030010O05 product:a disintegrin-like and metalloprotease (reprolysin
DE   type) with thrombospondin type 1 motif, 4, full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-3695
RA   Arakawa T., Carninci P., Fukuda S., Hashizume W., Hayashida K., Hori F.,
RA   Iida J., Imamura K., Imotani K., Itoh M., Kanagawa S., Kawai J., Kojima M.,
RA   Konno H., Murata M., Nakamura M., Ninomiya N., Nishiyori H., Nomura K.,
RA   Ohno M., Sakazume N., Sano H., Sasaki D., Shibata K., Shiraki T.,
RA   Tagami M., Tagami Y., Waki K., Watahiki A., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (14-APR-2004) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; 59b06e1fc47c3cca458b3e7634b0bb49.
DR   Ensembl-Gn; ENSMUSG00000006403; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000006570; mus_musculus.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=E030010O05
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3695
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /dev_stage="0 day neonate"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="E030010O05"
FT                   /tissue_type="lung"
FT                   /db_xref="taxon:10090"
FT   CDS             388..2925
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="a disintegrin-like and metalloprotease (reprolysin
FT                   type) with thrombospondin type 1 motif, 4 (MGD|MGI:1339949
FT                   GB|AK028364, evidence: BLASTN, 99%, match=3693)"
FT                   /note="putative"
FT                   /db_xref="GOA:Q3TNX8"
FT                   /db_xref="InterPro:IPR000884"
FT                   /db_xref="InterPro:IPR001590"
FT                   /db_xref="InterPro:IPR002870"
FT                   /db_xref="InterPro:IPR010294"
FT                   /db_xref="InterPro:IPR013273"
FT                   /db_xref="InterPro:IPR024079"
FT                   /db_xref="MGI:MGI:1339949"
FT                   /db_xref="UniProtKB/TrEMBL:Q3TNX8"
FT                   /protein_id="BAE37959.1"
FT                   /translation="MASIHPSCSPGTMSQMGLHPRRGLTGHWLQRFQPCLPLHTVQWRR
FT                   LLLLAFLLSLAWPASPLPREEEIVFPEKLNGSSILPGSGVPARLLYRLPAFGEMLLLEL
FT                   EQDPGVQVEGLTVQYLGQAPEMLGGAEPGTYLTGTINGDPESVASLHWDGGALLGVLQY
FT                   RGAELHLQPLEGGALNSAGGPGAHILRRKSPASSQGPMCTVKAPSGSPSPISRRTKRFA
FT                   SLSRFVETLVVADDKMAAFHGTGLKRYLLTVMAAAAKAFKHPSIRNPVNLVVTRLVILG
FT                   SGQEGPQVGPSAAQTLRSFCTWQRGLNTPNDSDPDHFDTAILFTRQDLCGVSTCDTLGM
FT                   ADVGTVCDPARSCAIVEDDGLQSAFTAAHELGHVFNMLHDNSKPCTNLNGQGGSSRHVM
FT                   APVMAHVDPEEPWSPCSARFITDFLDNGYGHCLLDKPEAPLHLPATFPGKDYDADRQCQ
FT                   LTFGPDSSHCPQLPPPCAALWCSGHLNGHAMCQTKHSPWADGTPCGSSQACMGGRCLHV
FT                   DQLKDFNVPQAGGWGPWGPWGDCSRTCGGGVQFSSRDCTRPVPRNGGKYCEGRRTRFRS
FT                   CNTENCPHGSALTFREEQCAAYNHRTDLFKSFPGPMDWVPRYTGVAPRDQCKLTCQARA
FT                   LGYYYVLEPRVADGTPCSPDTSSVCVQGRCIHAGCDRIIGSKKKFDKCMVCGGDGSRCS
FT                   KQSGSFKKFRYGYSDVVTIPAGATHILVRQQGGSGLKSIYLALKLSDGSYALNGEYTLM
FT                   PSPTDVVLPGAVSLRYSGATAASETLSGHGPLAQPLTLQVLVAGNPQNARLRYSFFVPR
FT                   PVPSTPRPPPQDWLQRRAEILKILRKRPWAGRK"
XX
SQ   Sequence 3695 BP; 786 A; 1028 C; 1062 G; 819 T; 0 other;
     tgaacccggg gaagacccac agatacacag aaacgagaga gacagaagag gagagagaca        60
     gagacaaaga gacagcagca ggaggaggag gaggaggagg caaagacagg gcgagcactg       120
     aggcaaagcc agacagctga gcagagggag aagccaagga gtcacagaca aagacctggg       180
     acagaaaggc aaaggaggaa gttttggagc agaaagaacc cgtgggcact tttcctgagc       240
     ccaggggctg ttttcttttt catcttctct gaaagtccct agcccattta aaaactttgc       300
     ctcagatttt ggcacaagcc ccaaagccct tctggcttta acgaggagcc ttccacagtt       360
     agggtgtgga gcattttggt gccgcagatg gcctcaatcc atcccagctg cagcccgggt       420
     accatgtccc agatgggctt gcatcccagg aggggcttga ctgggcactg gctgcaaaga       480
     ttccaaccct gcttgccgct tcacactgtg cagtggcgga ggctgctgct gctggccttc       540
     ctcctgtcct tagcgtggcc cgccagcccc ctcccccggg aggaggagat cgtgtttcca       600
     gagaagctca atggcagtag catcctacct ggatcaggcg ttcctgccag gctgctgtac       660
     cgattgccag cctttgggga gatgttgcta ctagaactag aacaggaccc tggggtgcag       720
     gtagagggtt tgactgtaca gtacctgggc caggcacctg agatgctggg tggggcagag       780
     ccaggtacct acctgactgg caccatcaat ggagatccgg agtcggtggc atctctgcac       840
     tgggacgggg gagccctatt aggggtactg cagtaccgtg gggccgaact ccacctccag       900
     cctctggaag gaggcgccct taactctgct gggggaccgg gggctcacat cctacgccgg       960
     aagagtcctg ccagcagcca aggtcccatg tgcaccgtca aggctccttc tgggagcccg      1020
     agtcccattt cccgcagaac caagcgcttc gcttctctga gtagattcgt ggagacactg      1080
     gtggtagcag atgacaagat ggcagcattc catggtacag ggttaaagcg ctacctgctg      1140
     acggttatgg cagctgccgc taaagccttt aaacacccaa gcatccgaaa ccctgtcaac      1200
     ttggtggtga cgcgcctggt gatcctgggg tccggccagg aagggcccca agtggggcca      1260
     agtgccgccc agaccctacg cagcttctgc acctggcagc ggggcctcaa cacccctaac      1320
     gactcagatc ctgaccactt tgacacagcc attctgttca cccggcagga cctgtgtggg      1380
     gtctccactt gtgacaccct gggtatggct gatgtgggca cagtgtgtga tccagctagg      1440
     agctgtgcta ttgtggaaga tgatgggctc cagtcagcct tcactgctgc tcatgaactg      1500
     ggccatgtct tcaacatgct ccatgataac tccaagccat gcactaactt gaatgggcag      1560
     gggggttcct ctcgccatgt catggctcct gtcatggccc atgtggaccc tgaagagccc      1620
     tggtcgccct gcagtgcccg attcatcact gacttcctgg acaatggtta tgggcactgc      1680
     ctcttagaca aaccggaggc tcccctccat ctaccagcga cttttcctgg caaggactat      1740
     gacgctgacc gccaatgcca actgaccttc ggtcctgact caagccattg tccacagctg      1800
     ccaccgccct gtgctgccct ctggtgctct ggccacctca atggccatgc catgtgccag      1860
     acgaagcact caccttgggc tgatggcact ccctgcgggt cttcacaggc ctgcatgggt      1920
     ggccgctgtc tgcacgtgga ccagctcaag gacttcaatg ttcctcaggc tggaggctgg      1980
     ggcccctggg gaccatgggg tgactgctcc aggacttgtg ggggtggtgt ccagttctcc      2040
     tcccgggatt gcacgaggcc cgtcccccgg aacggtggca agtattgtga gggccgccgg      2100
     actcgcttcc gctcctgcaa cacggagaac tgcccacacg gctcagcatt gaccttccgt      2160
     gaagagcagt gtgctgccta caaccaccga accgacctct tcaagagctt tccagggccc      2220
     atggactggg ttccgcgcta cacaggtgtg gcccctcgag accaatgcaa actcacctgc      2280
     caggcccggg cactgggcta ctactacgta ttggagcccc gggtggcaga tgggactccc      2340
     tgctccccag acacctcctc tgtctgtgtc cagggccgct gtatccatgc tggctgtgac      2400
     cggatcattg gctccaaaaa gaaatttgac aagtgcatgg tgtgcggcgg ggatggctct      2460
     cgctgcagca agcagtcggg ctccttcaaa aaattcaggt atggatacag cgatgtggtc      2520
     acgatccctg cgggggccac ccatatcctt gtacggcagc agggggggtc tggtctcaag      2580
     agcatctacc tggccctgaa gctttctgac ggttcttacg ccctcaatgg tgaatacacg      2640
     ctgatgccct ccccaacaga tgtggttctt cctggggcag tcagcttgcg ctacagcgga      2700
     gccacagcag cctcagagac actgtctgga catgggccgc tggcccagcc cttgacgctg      2760
     caagtcctgg tggctggcaa cccacagaat gcacgtctgc ggtacagttt ctttgtcccg      2820
     cggccagtcc cttcaacacc acgccctcct ccccaagact ggctgcaacg cagggcagag      2880
     atactgaaga tccttcggaa gcgtccctgg gcaggccgga aataacctca ctgtcccggc      2940
     tgcccttttt gggcgccggg gcctcggact catctgggag aatgagcagg cttctgcaac      3000
     tgcctcctgc taaaacacag tagggaggtg tagagggtga gatctgcctg cctcactgcc      3060
     ccaaaccgca ggctggccct gccctggctt cctgccctgg gaggcagtga tgtcttggtg      3120
     aatggaaagg ggctaggtga cagtacccta tctactaaac tgccccctct accctgcagg      3180
     tcacaggagg aatgggggga agacagggtg ggtcctgggc cctagttgta tttatttggt      3240
     atttattcat ttttatttag caccaggaaa ggggactagg gtcttgggga aactcaccca      3300
     ttatagccct aacctagcta tgaaatccag ggtgttggtg acaaatatga gtggtgtgtg      3360
     tgtgtgtgtg tgtgtgtgtg tgtgtgttta tgtatgaggt acaacctgcc ctgctttcct      3420
     ctccctaatt tttttttttt ttctgggaaa aggaaagtca aaggtaggac tgccttcagg      3480
     gagtaaggga tgattgtgtt tttaaattga agtttgctat ttatatgctc tttttggagt      3540
     cagacaaatg tgggttatat tctggccccg catctttgag cattagtttt ctcatgtgcc      3600
     aataataatc ccttagaaat tggttgtaag gattaaatga tgttaataaa gaactagcat      3660
     agagcctctc actcagtagg tgctcaagga atggt                                 3695
//


spacer
spacer