spacer

EBI Dbfetch

ID   AK164837; SV 1; linear; mRNA; HTC; MUS; 3332 BP.
XX
AC   AK164837;
XX
DT   09-SEP-2005 (Rel. 85, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 10)
XX
DE   Mus musculus 15 days embryo head cDNA, RIKEN full-length enriched library,
DE   clone:D930009N18 product:gamma-aminobutyric acid (GABA-A) receptor, subunit
DE   theta, full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-3332
RA   Arakawa T., Carninci P., Fukuda S., Hashizume W., Hayashida K., Hori F.,
RA   Iida J., Imamura K., Imotani K., Itoh M., Kanagawa S., Kawai J., Kojima M.,
RA   Konno H., Murata M., Nakamura M., Ninomiya N., Nishiyori H., Nomura K.,
RA   Ohno M., Sakazume N., Sano H., Sasaki D., Shibata K., Shiraki T.,
RA   Tagami M., Tagami Y., Waki K., Watahiki A., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (14-APR-2004) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; b3b15d85e9b91bf27c4e31b34a6b217b.
DR   Ensembl-Gn; ENSMUSG00000031344; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000114553; mus_musculus.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=D930009N18
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3332
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /dev_stage="15 days embryo"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="D930009N18"
FT                   /tissue_type="head"
FT                   /db_xref="taxon:10090"
FT   CDS             <1..248
FT                   /codon_start=3
FT                   /transl_table=1
FT                   /note="gamma-aminobutyric acid (GABA-A) receptor, subunit
FT                   theta (MGD|MGI:1888498 GB|AK038859, evidence: BLASTN, 100%,
FT                   match=961)"
FT                   /note="putative"
FT                   /note="start codon is not identified"
FT                   /db_xref="GOA:Q3TP00"
FT                   /db_xref="MGI:MGI:1888498"
FT                   /db_xref="UniProtKB/TrEMBL:Q3TP00"
FT                   /protein_id="BAE37937.1"
FT                   /translation="TQLATGESLSDLPSTSEQTVPECTIHFHGFLTNDSIIPIKIHSRS
FT                   DACDDEDSEESLSSEESHGHGSSHTGRLKLQISQSA"
FT   polyA_signal    3317..3322
FT                   /note="putative"
FT   polyA_site      3332
FT                   /note="putative"
XX
SQ   Sequence 3332 BP; 946 A; 720 C; 686 G; 980 T; 0 other;
     ggactcaatt ggccactgga gaaagcctga gtgatctgcc ctccacctct gagcaaacag        60
     tgcctgagtg taccattcac tttcatggct ttcttactaa tgacagtatt atccccatca       120
     aaatccacag ccgatctgat gcctgtgatg atgaagactc cgaagaaagc ctaagctctg       180
     aggagagcca tggccatgga agcagccaca ctggaaggct caagctccag attagccaga       240
     gtgcatagta agtgtcaacg agctccctga cccatcacat cgttggatcc tcacaggagc       300
     cctgtgagcc agggaagaca aagcaccttg tccccagtgt tccaaggaaa atgtggagct       360
     tgtgtgccat gcttaaagat gcttgttctt ttccttatct gcttaactct caactaactg       420
     ccccttccct gtgctcaagc tgccaagctc atggacagca cccggaacat ctctatatga       480
     agaggccagc tggtgaacat ggagcctact cagcagggct cctgataaga gtgggatgag       540
     cctgtacacc aactttccag gaagcaccag cttattgatg gaggtcatga gggagctttc       600
     ccaagcactc aacctatatc cccccttcct ctataggcag cctctccttc agccctatac       660
     tcctctgccc acccgccttc ttaagtatac tcctgtactt ctatatttat atgtttctgc       720
     gtatctctga ggatgactat gtatgtattc aggtaggtat atgtgctatc catacaacca       780
     tctgagaagc tgtactagtg ccaatctaca ctgtgtggat aaatagtatg tatgcatctc       840
     tatgagagtg tcacttgtag tgtcacttat agtaacagag ctgaatgcat tctgcataca       900
     ttcatagaat gtgcatgtct atatacctgt gtttgtcaaa gttagttagt gtaaaaggat       960
     atacataaaa aaaaaaaaac acatgtattc cctttaggag gttcttgtag aaacagcatg      1020
     actctagtga cctgttttag cagagtgggg acagtcttag ttagctggac tgattaactc      1080
     tttcttttca gttcttgaga gccaggtgga cctattggta aagtacattt gtagctaatc      1140
     cttggacagg cttggctgct tgaacaggcc cacaaatcta ccttgtgttt ggagtttgaa      1200
     cattccttac tttaacttga ttccgggaaa gactcagaga agtaaaaatg gacaggagaa      1260
     ctaagtactg aatagatgat ctcagtattg tctcttgtcc atgcataggc acaattctag      1320
     ccttttatgc atacacaccc agacacatat acctactcca ttacatgtgc atacatatat      1380
     ttcatgagca cccacgcact gggttatatt tacaagcatg tccagatata tacacacaca      1440
     aataaacaca cacacacaca tacttttaaa acaactcaaa acaaggatat ttttaccaaa      1500
     atatctaaga ttgtttattt ggggggcggg gggagaaccc agcataaaac ggtccagatt      1560
     aaagggagag caaaagctct cctctggaat ctgagcattc gttagatgtg cacttggatc      1620
     tggagaccta tataatcttg tagtgttgaa cacatcactg gactaaagtt actaagaggg      1680
     attagagtag tgggaccaac gataaagtag agaagaggca gagaggccag ttgtaaatat      1740
     ccatgtagct agatatagca taccctaaaa agactatttt gccctaatgt gctgcaatga      1800
     gagcagttaa actgcaattc atactatgtg aggttacatg taccatggag atctggtaat      1860
     gacagctttt caggaacttg aatcatctgg gttgtttttg tttttttgtt ttttgttttt      1920
     gttgttgttg ttgttgttgt tgttgttgtt gttatttttc atggctatgg tctttcttac      1980
     ttgaaagttg ccagatctct ccttgtattc tctgtgtggt ctgttgttta tcttcattaa      2040
     gccctgtatc ctgctgccct cagccccttt tcagccatac aggcacaccc tctctattgg      2100
     ctgcctatgt ctcctcccaa acttcctcca acaccaagta gttgttgaag tgcagagcat      2160
     ctgagcagtg ctcctgaggt tcagtcagtc caacagcttg gaaagaagga agagccttac      2220
     taagtctgag atggagcaac cccactttac tactctattc tgtcttgtct taccctctcc      2280
     tgtcccccta gaattcctgt ctgagaaaga ccccagcttt ctgtctttcc aatgcatcat      2340
     tttattgtag aaatatgtga tataattcct gcccagcttg atttgcactg tggggtgtct      2400
     ctgcagagtt tggccattgt agtcttacaa tttgtatcat ccttattcat agcaaggctg      2460
     caaactcttg acatacctaa accaagtttt gctgagattg tgaccattcc taatgaggat      2520
     tccttactct gtatatacag cagcaatgct ttcaagctat taagtactga aagccctcac      2580
     taagcactcc acctgcatgc taccctgtgg tagtaagcag gaactttcta gctactccac      2640
     agcccagcat tcaaagtaat tatcccttgt cctactgaaa gtgcagtgtg tttgtgtttc      2700
     tgtttgtgtt tgttgtatgg tgtcctgaga ttaatatgaa tctacatttt cagtgttggg      2760
     ttttcagagg agggaaggaa tgatgttaaa atatctctct ggtattcttc aataataaaa      2820
     tatgccagct ggtcaaggtc atctgtgtag aactctgggt cagaattttc acccactatc      2880
     atgctagact atatccctga gatcagtatt cattagtaaa ggcaacttac cagaattctg      2940
     cacagtaata gaagccaact tcagataata ccagaggagt ctttcagtgg ctattaagtt      3000
     agtaacattc tgggagcata tgaactatgg taaagtcaca tacatacaga tcttcagtag      3060
     tggtgtaggg ccaagacaat aaaaagtaag aaaatagaat gaccaacagc caggtaaccc      3120
     gggtgagctg acctgcaagg gccacagaag cagagcctta ctagataagt gggtgcccat      3180
     gttgagctca ttaattgaca ttgttgtgag aaagagacct tgaccagtcc ggacttcaag      3240
     aaagtgaaac atgaaagagc ataaaatcat gcttctgaaa aatatacttt aaaaacatgt      3300
     aaatagcaaa aggcaaaata aagatctata at                                    3332
//


spacer
spacer