Dbfetch

ID   AK162677; SV 1; linear; mRNA; HTC; MUS; 1725 BP.
XX
AC   AK162677;
XX
DT   09-SEP-2005 (Rel. 85, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 10)
XX
DE   Mus musculus adult female vagina cDNA, RIKEN full-length enriched library,
DE   clone:9930010N10 product:3-phosphoinositide dependent protein kinase-1,
DE   full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1725
RA   Arakawa T., Carninci P., Fukuda S., Hashizume W., Hayashida K., Hori F.,
RA   Iida J., Imamura K., Imotani K., Itoh M., Kanagawa S., Kawai J., Kojima M.,
RA   Konno H., Murata M., Nakamura M., Ninomiya N., Nishiyori H., Nomura K.,
RA   Ohno M., Sakazume N., Sano H., Sasaki D., Shibata K., Shiraki T.,
RA   Tagami M., Tagami Y., Waki K., Watahiki A., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (14-APR-2004) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science, e1252229 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science, e1252229 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; 03b26481eab8c009695e0ed7491e3a17.
DR   Ensembl-Gn; ENSMUSG00000024122; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0023288; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0023248; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0023215; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0023253; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0023013; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0023696; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0022515; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0022989; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0023118; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0023088; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0023195; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0023107; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0023734; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0022264; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0022578; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000115411; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0045881; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0045859; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0045812; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0045824; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0045556; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0046309; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0045662; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0045487; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0045609; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0045577; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0045711; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0045551; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0046392; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0045247; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0044932; mus_musculus_wsbeij.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=9930010N10
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1725
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /sex="female"
FT                   /dev_stage="adult"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="9930010N10"
FT                   /tissue_type="vagina"
FT                   /db_xref="taxon:10090"
FT   CDS             95..1663
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="3-phosphoinositide dependent protein kinase-1
FT                   (MGD|MGI:1338068 GB|AF079535, evidence: BLASTN, 99%,
FT                   match=1654)"
FT                   /note="putative"
FT                   /db_xref="GOA:Q3TRL2"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR033931"
FT                   /db_xref="MGI:MGI:1338068"
FT                   /db_xref="UniProtKB/TrEMBL:Q3TRL2"
FT                   /protein_id="BAE37017.1"
FT                   /translation="MARTTSQLYDAVPIQSSVVLCSCPSPSMVRSQTEPGSSPGIPSGV
FT                   SRQGSTMDGTTAEARPSTNPLQQHPAQLPPQPRKKRPEDFKFGKILGEGSFSTVVLARE
FT                   LATSREYAIKILEKRHIIKENKVPYVTRERDVMSRLDHPFFVKLYFTFQDDEKLYFGLS
FT                   YAKNGELLKYIRKIGSFDETCTRFYTAEIVSALEYLHGKGIIHRDLKPENILLNEDMHI
FT                   QITDFGTAKVLSPESKQARANSFVGTAQYVSPELLTEKSACKSSDLWALGCIIYQLVAG
FT                   LPPFRAGNEYLIFQKIIKLEYHFPEKFFPKARDLVEKLLVLDATKRLGCEEMEGYGPLK
FT                   AHPFFETITWENLHQQTPPKLTAYLPAMSEDDEDCYGNYDNLLSQFGFMQVSSSSSSHS
FT                   LSTVETSLPQRSGSNIEQYIHDLDTNSFELDLQFSEDEKRLLLEKQAGGNPWHQFVENN
FT                   LILKMGPVDKRKGLFARRRQLLLTEGPHLYYVDPVNKVLKGEIPWSQELRPEAKNFKTF
FT                   FVHTM"
FT   regulatory      1706..1711
FT                   /note="putative"
FT                   /regulatory_class="polyA_signal_sequence"
FT   polyA_site      1725
FT                   /note="putative"
XX
SQ   Sequence 1725 BP; 483 A; 413 C; 408 G; 421 T; 0 other;
     gcattgctgg ggctccgccg cggggaggag gacgctgagg aggcgccgag cagcgcaacg        60
     ctgcggggga ggcgcccgcg ccgacttggg gctcatggcc aggaccacca gccagctgta       120
     tgacgctgtg cccattcagt ccagtgtggt gctatgttcc tgcccatccc catcaatggt       180
     gaggtcccag actgagcccg gttcgtcccc tggcattcct agtggtgtta gcaggcaggg       240
     atccaccatg gatggcacca cagctgaagc ccgaccaagc accaacccct tgcagcagca       300
     ccctgcccag ctgccaccac agcctcgcaa gaaacgccct gaagacttca agtttgggaa       360
     aattcttggc gagggctctt tttcaacagt tgttctggcc cgagaactgg ccacttccag       420
     agaatatgct attaaaattc tggagaaacg tcatattata aaagaaaaca aagttccgta       480
     tgtaactaga gagagagatg tgatgtcacg cctggatcac cccttctttg tgaaacttta       540
     ttttacattt caggacgacg aaaagctgta ttttggcctt agttatgcca aaaatggaga       600
     gctacttaaa tacatccgca aaattggctc atttgatgag acctgtaccc ggttttacac       660
     ggctgagatt gtgtctgctt tagagtactt gcatggcaag ggcatcattc acagagacct       720
     taaaccagaa aacattttgt taaatgaaga catgcacatc cagatcacag attttggaac       780
     agcaaaagtg ttatccccag agagcaaaca agccagggcc aactcatttg taggaacagc       840
     acagtatgtt tctccagagc tgctcacaga gaagtcggcg tgtaaaagtt cagacctttg       900
     ggcccttgga tgtataatct atcagctcgt ggcaggactc ccaccattca gagccgggaa       960
     tgaatatctt atatttcaga agatcattaa gctggaatat catttcccag aaaaattctt      1020
     ccctaaggct agagatcttg tggaaaaact cttggtttta gatgccacaa agcgtttagg      1080
     ctgtgaagag atggaagggt acgggcctct caaagctcat ccattctttg agaccatcac      1140
     ttgggagaat ttgcaccagc agacacctcc gaagctcaca gcttacctac cagccatgtc      1200
     agaggatgat gaagactgct atggcaacta cgacaatctc ctgagccagt ttggcttcat      1260
     gcaggtgtca tcctcctcct cttcccactc cctgtctacg gtggaaacca gcctgcccca      1320
     gaggtcgggc agcaacatag agcagtacat ccatgatttg gacactaact cttttgaact      1380
     agacttacag ttttcagaag atgaaaaaag gttgttattg gaaaagcaag ccggtggaaa      1440
     cccttggcac cagtttgtag aaaataatct aatattaaaa atgggtccag tggataagcg      1500
     aaagggttta tttgcaagac gacgacagtt attactcaca gaagggccac atttatatta      1560
     tgttgatcct gtcaacaagg tcttgaaagg tgaaatccca tggtcacaag aactccgacc      1620
     agaagccaag aattttaaaa ctttctttgt ccacacgatg taattaccgg atgatggatt      1680
     tccctcgtat gctcggtagt cttgtaataa aagcatgtag agtgt                      1725
//