spacer

EBI Dbfetch

ID   AK162391; SV 1; linear; mRNA; HTC; MUS; 3564 BP.
XX
AC   AK162391;
XX
DT   09-SEP-2005 (Rel. 85, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 11)
XX
DE   Mus musculus adult male diencephalon cDNA, RIKEN full-length enriched
DE   library, clone:9330023B06 product:calcitonin receptor, full insert
DE   sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-3564
RA   Arakawa T., Carninci P., Fukuda S., Hashizume W., Hayashida K., Hori F.,
RA   Iida J., Imamura K., Imotani K., Itoh M., Kanagawa S., Kawai J., Kojima M.,
RA   Konno H., Murata M., Nakamura M., Ninomiya N., Nishiyori H., Nomura K.,
RA   Ohno M., Sakazume N., Sano H., Sasaki D., Shibata K., Shiraki T.,
RA   Tagami M., Tagami Y., Waki K., Watahiki A., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (14-APR-2004) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; da6965d352aa76b098fd8c1a05c55e11.
DR   Ensembl-Gn; ENSMUSG00000023964; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000075644; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000115622; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000168592; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000170266; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000171613; mus_musculus.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=9330023B06
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3564
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /sex="male"
FT                   /dev_stage="adult"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="9330023B06"
FT                   /tissue_type="diencephalon"
FT                   /db_xref="taxon:10090"
FT   CDS             310..1911
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="calcitonin receptor (MGD|MGI:101950 GB|AK039161,
FT                   evidence: BLASTN, 99%, match=3563)"
FT                   /note="putative"
FT                   /db_xref="GOA:Q60755"
FT                   /db_xref="InterPro:IPR000832"
FT                   /db_xref="InterPro:IPR001688"
FT                   /db_xref="InterPro:IPR001879"
FT                   /db_xref="InterPro:IPR003287"
FT                   /db_xref="InterPro:IPR017981"
FT                   /db_xref="InterPro:IPR017983"
FT                   /db_xref="MGI:MGI:101950"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q60755"
FT                   /protein_id="BAE36888.1"
FT                   /translation="MTPRRSRVKRRNLRKPKMRFLLVNRFTLLLLLLVSPTPVLQAPTN
FT                   LTDSGLDQEPFLYLVGRKKLLDAQYKCYDRIHQLPSYEGEGLYCNRTWDGWMCWDDTPA
FT                   GATAYQHCPDYFPDFDTAEKVSKYCDENGEWFRHPDSNRTWSNYTLCNAFTSEKLQNAY
FT                   VLYYLALVGHSLSIAALVASMLIFWIFKNLSCQRVTLHKHMFLTYILNSIIIIIHLVEV
FT                   VPNGDLVRRDPMHIFHHNTHMWTMQWELSPPLPLSAHEGKMDPHASEVISCKVLHFLHQ
FT                   YMMSCNYFWMLCEGIYLHTLIVMAVFTDEQRLRWYYLLGWGFPIVPTIIHAITRALYYN
FT                   DNCWLSAETHLLYIIHGPVMVALVVNFFFLLNIVRVLVTKMRQTHEAESYMYLKAVKAT
FT                   MVLVPLLGIQFVVFPWRPSNKVLGKIYDYLMHSLIHFQGFFVATIYCFCNHEVQVTLKR
FT                   QWTQFKIQWSQRWGRRRRPTNRVVSAPRAVAFAEPDGLPIYICHQEPRNPPISNNEGEE
FT                   STEMIPMNVIQQDASA"
XX
SQ   Sequence 3564 BP; 947 A; 853 C; 766 G; 998 T; 0 other;
     gagtggagaa ggggaattgt cctcaacacc aagtcaggag agccagccgc ccaagactct        60
     gggcggactg cacctggctg gcttgcagac aactcttggt tggagaggtg cttacttctg       120
     cgcctcaccc tgccgttggc atcccctgcc tgcagatgcc cagtgaagtc tgcgttcctg       180
     agaacacctg agctgtgccc agacatccag caagagaatt cctgcatcca cctaaggtaa       240
     gtgccattag agcgccttcc agaggagaag aaaccgaggg agcagggcta ctacacagag       300
     gatttgaaaa tgactccaag gaggtccaga gtgaaaaggc ggaatctccg caaaccgaag       360
     atgaggttcc ttctcgtgaa caggttcacc ctgctgctcc tgctcctagt gagcccaact       420
     ccagttcttc aggctcctac caatctcact gactccggcc ttgatcagga gccattcctg       480
     tacttggttg gccgcaagaa gctgctggat gctcagtaca aatgctatga ccggattcat       540
     cagttgccct cttatgaagg agaaggtctg tactgcaacc gcacctggga tggctggatg       600
     tgctgggacg acactcccgc tggagccaca gcctatcagc actgccctga ctacttcccg       660
     gactttgaca cagcagaaaa ggtttcaaaa tactgtgatg aaaatggaga gtggtttaga       720
     caccctgaca gcaaccgaac ctggtccaac tatactctgt gcaacgcttt cacttctgag       780
     aaactgcaaa atgcgtacgt tctttattac ctggctcttg tgggtcactc cttgtcgatt       840
     gctgctttgg ttgcttccat gctgatcttc tggattttca agaaccttag ctgccagagg       900
     gtgaccttgc acaagcacat gttccttact tatattctga attctatcat tatcatcatc       960
     cacctggttg aggttgtgcc caatggagat ctggtgcggc gggatcctat gcatattttt      1020
     catcataaca cacatatgtg gacaatgcag tgggaactgt caccaccctt acccctgagt      1080
     gcacacgagg gaaagatgga ccctcatgcc agtgaagtga taagttgcaa ggttctacac      1140
     tttttacatc agtacatgat gtcttgcaac tacttctgga tgctctgcga ggggatctat      1200
     cttcatactc tgattgtcat ggctgtgttt accgacgagc aacgcctacg ctggtactat      1260
     cttcttggct gggggttccc gatagtgcca accattatcc acgccatcac tcgtgccctc      1320
     tactacaacg acaactgctg gctgagtgca gaaacccact tgctttacat catccatgga      1380
     cccgtcatgg tggctctggt ggtcaacttc ttctttcttc tcaacattgt ccgcgtgctt      1440
     gtgaccaaga tgaggcaaac ccacgaggcc gagtcctaca tgtacctgaa ggctgtgaag      1500
     gccaccatgg tccttgtgcc cctgctgggg atccagtttg ttgtgtttcc ctggaggccc      1560
     tccaacaagg tgcttgggaa gatctatgat tatctcatgc actctctgat tcatttccag      1620
     ggattctttg tggcgactat ctactgcttc tgcaaccatg aggtgcaagt caccctgaag      1680
     cgccagtgga cgcagttcaa gatccagtgg agccaacgct ggggaaggcg ccgccgcccc      1740
     accaaccgcg tagttagtgc tcctcgggct gtagccttcg ctgagccaga tggcctcccc      1800
     atttacatct gccatcagga accacggaat cctccaatca gcaacaacga aggcgaggag      1860
     agtactgaaa tgatccccat gaacgtcatc cagcaagacg catccgcttg aatgtgaagc      1920
     caccccaagc attgtgatcc actgagcctt catttcctgg ggaaagacag accatgtgtt      1980
     tcaagtgatt cccatcctcc caggagctga ccatatcatt tgtgaagaag tgttaagtga      2040
     atttgtccat agtgaatttg aagaaagtga ttcttggtac tattgctttg ggagtcagtc      2100
     taggaataga gtctcccatt gcaacttgtg aactccatca ttcatcctgg actgagatga      2160
     ctgtgttcgt aggaaagcag gcaaggtgtt caaaagatgt cacactattg acctagttca      2220
     gatacagggt gctccttgtg aattttgagc catttgtacc gttgagaaat taaaatcact      2280
     ctcaatgttt ttaaatttga cactggattt tgaattagac tatttctgta tttgactaca      2340
     gatctggttt ttaatgtttt tatttcagtc agttcctata ttacacatgt taccatccat      2400
     acaatgtcaa ctacacatat agcatgacct ctgaaagatg gtgtgtcttt tataacatga      2460
     tccagttcac caggcagacc caaatgctgt aatgaattga tctgaacctt gtatgtgctt      2520
     tggtcactga catttataag ttgggaggtc accaagaacc tatcaccaaa tttatcacaa      2580
     aactgccctc caaaatgtaa caatctttaa agagagtttt ccactttcct aaactacagg      2640
     atttataaaa caaatcactc caaggtttat aaagcagatt acctcttgcc cttgggtgct      2700
     atctagcagt aagagaaaga tttgtttacg actggtaatt aaaagactcc atacaagtcc      2760
     attaactgcc ttccacccag cttcaaagct aaacaagatc cctgtgtttt tcaagaagac      2820
     tctgtgtggc taattacaaa tcagtttctt gttgacctct tgcttgctgc tattagcaaa      2880
     acaagagggg gaaaaaaccc acaatgtagg gacttcaaat ttaacctcat attaattcat      2940
     cttaaattaa aaacagagct tctcatcaaa acccagtact atatctccat acccctcttt      3000
     actccccagt aggagatcat ctaagatcca tgaataaacc aataccatca cagatttctg      3060
     aatctgcaac agtaaccagt catcattact taatttgtat gctaaatgag gagctttttt      3120
     gagaccctca aaatctcctc tcacctttgt aatcttttgt cactgccttt cagaggtgat      3180
     ttagttgtgt aaagacaaaa gtaacttgat ttgttctggt tacatgcttg gtgtacccag      3240
     agaaaactgt atttcaatag caactgtgga ccttggatac tgagagttgc ctttaccaaa      3300
     atggaaggac ggattgaagg aaggatgttt tttcaatcac agtgttacct ggtgatgtcc      3360
     ctatgttttg tttacacaca tcgaaatcag tgtatttcag gcagctctag tacaaatgtg      3420
     ataatatatt gaagtgtttg agatgttatt gtgcttatgt agtaggagct gatgaaatca      3480
     aactgactta ccataacatt gcatgtcata cctaaattgt gtgaaacgct tctgctgtgt      3540
     acatgtataa atacagagca tatt                                             3564
//


spacer
spacer