spacer

EBI Dbfetch

ID   AK162276; SV 1; linear; mRNA; HTC; MUS; 1358 BP.
XX
AC   AK162276;
XX
DT   09-SEP-2005 (Rel. 85, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 10)
XX
DE   Mus musculus 15 days embryo male testis cDNA, RIKEN full-length enriched
DE   library, clone:8030467M07 product:regulator of G-protein signaling 2, full
DE   insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1358
RA   Arakawa T., Carninci P., Fukuda S., Hashizume W., Hayashida K., Hori F.,
RA   Iida J., Imamura K., Imotani K., Itoh M., Kanagawa S., Kawai J., Kojima M.,
RA   Konno H., Murata M., Nakamura M., Ninomiya N., Nishiyori H., Nomura K.,
RA   Ohno M., Sakazume N., Sano H., Sasaki D., Shibata K., Shiraki T.,
RA   Tagami M., Tagami Y., Waki K., Watahiki A., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (14-APR-2004) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; 65311a3893f3ccc8528215c0ede3a12b.
DR   Ensembl-Gn; ENSMUSG00000026360; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000127206; mus_musculus.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=8030467M07
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1358
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /sex="male"
FT                   /dev_stage="15 days embryo"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="8030467M07"
FT                   /tissue_type="testis"
FT                   /db_xref="taxon:10090"
FT   CDS             34..669
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="putative"
FT                   /note="regulator of G-protein signaling 2 (MGD|MGI:1098271
FT                   GB|NM_009061, evidence: BLASTN, 99%, match=1356)"
FT                   /db_xref="GOA:O08849"
FT                   /db_xref="InterPro:IPR000342"
FT                   /db_xref="InterPro:IPR016137"
FT                   /db_xref="InterPro:IPR024066"
FT                   /db_xref="MGI:MGI:1098271"
FT                   /db_xref="UniProtKB/Swiss-Prot:O08849"
FT                   /protein_id="BAE36830.1"
FT                   /translation="MQSAMFLAVQHDCVPMDKSAGNGPKVEEKREKMKRTLLKDWKTRL
FT                   SYFLQNSSAPGKPKTGKKSKQQTFIKPSPEEAQLWAEAFDELLASKYGLAAFRAFLKSE
FT                   FCEENIEFWLACEDFKKTKSPQKLSSKARKIYTDFIEKEAPKEINIDFQTKSLIAQNIQ
FT                   EATSGCFTTAQKRVYSLMENNSYPRFLESEFYQDLCKKPQITTEPHAT"
XX
SQ   Sequence 1358 BP; 409 A; 280 C; 327 G; 342 T; 0 other;
     gaaaacagct gcggtggccg cgggagtctg agaatgcaaa gtgccatgtt cctggctgtc        60
     cagcacgact gcgtacccat ggacaagagt gcaggcaacg gccccaaggt cgaggagaag       120
     cgggagaaaa tgaagcggac actcttaaag gattggaaga cccgtttgag ctacttcttg       180
     cagaattcct ctgctcctgg gaagcccaaa actggcaaga aaagcaaaca gcaaactttt       240
     atcaagcctt ctcctgagga agcgcagctc tgggcagaag catttgatga actgctggcc       300
     agtaaatatg ggctggctgc attcagggcg tttttaaagt ccgagttctg tgaagaaaac       360
     attgaattct ggttggcttg tgaagacttc aaaaaaacca aatcacccca aaaactgtcc       420
     tcaaaagcaa ggaaaatcta taccgacttc atagagaagg aagctcccaa agagataaac       480
     atagacttcc aaacgaaatc tctgattgcc caaaatatcc aagaggctac aagtggctgc       540
     ttcaccacag ctcagaagag ggtgtacagt ttgatggaga acaattctta tcctcggttc       600
     ttggagtccg aattctacca ggacttatgt aaaaagccac agatcaccac ggagccccat       660
     gctacatgag accaggagtc cccccacaca caaaggacat tccattctgt ctcccaagag       720
     caaaggctgt gacctgccag aaaaaaaaaa aaaaactgac cttgaattca gcctgagtgt       780
     taggaaaaca tcgctcagaa ctattgattc aatgttgggt agtgaatcag gaagtcagca       840
     acctaggaga ggctctgtgt gagaacggct tccctcactg tgtgaagaac agagggagag       900
     aacaggcctc tgaatgtgtt cttcctcctt gtcgggaaag cagagtttga gatgaaagat       960
     ccgatgcaat gttgttggag catttaaaat caataggtct gggattatgt ggccttagct      1020
     agttggctgt acaccttccc taaactagtc catgttacca catagtggtg ttagttctag      1080
     ttttaatatt ttagtactaa gtaacattac aatgtttact gtgtgcaagg gtgttgacgt      1140
     tcttaggact acagatcatt agtactagtg tgtcacgtat cactgaaact gagaagtatg      1200
     tttgagttgt taaatggtgt gtgtgatgga ccgaatgctg tgccgtgctg tagaaccagc      1260
     gtctgttacg agtgccaaaa actgtcttgc gggcagctaa actttgaagt ggtttttgaa      1320
     tacttttaat aaatttattt tgctaaataa tgtcattg                              1358
//


spacer
spacer