spacer

EBI Dbfetch

ID   AK161971; SV 1; linear; mRNA; HTC; MUS; 1349 BP.
XX
AC   AK161971;
XX
DT   09-SEP-2005 (Rel. 85, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 10)
XX
DE   Mus musculus adult male olfactory brain cDNA, RIKEN full-length enriched
DE   library, clone:6430701G01 product:syntaxin 4A (placental), full insert
DE   sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1349
RA   Arakawa T., Carninci P., Fukuda S., Hashizume W., Hayashida K., Hori F.,
RA   Iida J., Imamura K., Imotani K., Itoh M., Kanagawa S., Kawai J., Kojima M.,
RA   Konno H., Murata M., Nakamura M., Ninomiya N., Nishiyori H., Nomura K.,
RA   Ohno M., Sakazume N., Sano H., Sasaki D., Shibata K., Shiraki T.,
RA   Tagami M., Tagami Y., Waki K., Watahiki A., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (14-APR-2004) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; fc0837d4cf0f844249bb70073c77cdf9.
DR   Ensembl-Gn; ENSMUSG00000030805; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000033075; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000121705; mus_musculus.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=6430701G01
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1349
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /sex="male"
FT                   /dev_stage="adult"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="6430701G01"
FT                   /tissue_type="olfactory brain"
FT                   /db_xref="taxon:10090"
FT   CDS             225..1121
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="putative"
FT                   /note="syntaxin 4A (placental) (MGD|MGI:893577
FT                   GB|NM_009294, evidence: BLASTN, 99%, match=1347)"
FT                   /db_xref="GOA:P70452"
FT                   /db_xref="InterPro:IPR000727"
FT                   /db_xref="InterPro:IPR006011"
FT                   /db_xref="InterPro:IPR006012"
FT                   /db_xref="InterPro:IPR010989"
FT                   /db_xref="MGI:MGI:893577"
FT                   /db_xref="PDB:3PUJ"
FT                   /db_xref="PDB:3PUK"
FT                   /db_xref="UniProtKB/Swiss-Prot:P70452"
FT                   /protein_id="BAE36660.1"
FT                   /translation="MRDRTHELRQGDNISDDEDEVRVALVVHSGAARLGSPDDEFFQKV
FT                   QTIRQTMAKLESKVRELEKQQVTILATPLPEESMKQGLQNLREEIKQLGREVRAQLKAI
FT                   EPQKEEADENYNSVNTRMKKTQHGVLSQQFVELINKYNSMQSEYREKNVERIRRQLKIT
FT                   NAGMVSDEELEQMLDSGQSEVFVSNILKDTQVTRQALNEISARHSEIQQLERSIRELHE
FT                   IFTFLATEVEMQGEMINRIEKNILSSADYVERGQEHVKIALENQKKARKKKVMIAICVS
FT                   VTVLILAVIIGITITVG"
XX
SQ   Sequence 1349 BP; 338 A; 309 C; 429 G; 273 T; 0 other;
     tgggggaaga gaagggaatt ccaacctgta gaactttggg ggtcctatga tcgggttctt        60
     ccccacgact gtggatggtg aaaggggtgg ggcctttggc ggctccgggg tgtactggag       120
     ttcgctgggt gagggagggg gtgtcaagtg tgagagaggt gcaggacttc caaatttaga       180
     accttgaggc cctttgggct cgggtccagg gcactccgac caccatgcgc gacaggaccc       240
     acgagttgag gcagggggat aacatctcag acgatgaaga tgaggttcga gtcgcgctgg       300
     tggtgcactc aggtgctgcc cggttgggca gcccggacga cgagttcttc cagaaggtgc       360
     agacaattcg gcagactatg gccaaactgg agagtaaagt ccgggagttg gagaaacagc       420
     aggtcaccat cctggccacg cctcttcccg aggagagcat gaagcagggc ctgcagaacc       480
     tgcgagagga gatcaaacag ctggggagag aggtccgggc gcagctaaaa gccatagagc       540
     cccagaagga ggaagctgat gagaattaca actcagtcaa cacaaggatg aagaaaaccc       600
     agcatggagt cctgtcccag caatttgtcg agctcatcaa caagtacaac tcaatgcagt       660
     ccgaataccg agagaagaat gtggagcgga tccggaggca gctgaagatc accaatgctg       720
     gaatggtgtc tgacgaggag ctggaacaga tgctggacag tgggcagagt gaggtgtttg       780
     tgtctaatat cctgaaggac acgcaggtga ctcggcaggc cctgaatgag atctctgcgc       840
     ggcacagtga gatccagcag ttggagcgca gtatccgaga gctccatgag atctttacgt       900
     ttctagctac ggaggtggag atgcaggggg agatgatcaa ccgcatcgag aagaacatcc       960
     tgagctcggc cgactacgtg gaacgtgggc aagagcacgt caagatagcc ctagagaatc      1020
     agaagaaggc gaggaagaaa aaagtcatga ttgccatctg tgtctctgtc actgttctca      1080
     tcttggctgt catcattggc atcaccataa ccgttggata atgtcacatg ttcttggcat      1140
     tgggagagac agagacccag cttttgtgga ggtggggcag gcctccaact gaacccgtcc      1200
     gcacactgga ccttgtgcag agggcctgcg gctcgtcctg ggttggcagc tgctcattca      1260
     tggagtcctc ccctggagtc ctccacaatg cctgcgagac agttttcaat gtcctgtttg      1320
     tctgggatac atggttttgt aaaaaattc                                        1349
//


spacer
spacer