Dbfetch

ID   AK161821; SV 1; linear; mRNA; HTC; MUS; 2645 BP.
XX
AC   AK161821;
XX
DT   09-SEP-2005 (Rel. 85, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 10)
XX
DE   Mus musculus 13 days embryo male testis cDNA, RIKEN full-length enriched
DE   library, clone:6030478C10 product:G protein-coupled receptor kinase 5, full
DE   insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2645
RA   Arakawa T., Carninci P., Fukuda S., Hashizume W., Hayashida K., Hori F.,
RA   Iida J., Imamura K., Imotani K., Itoh M., Kanagawa S., Kawai J., Kojima M.,
RA   Konno H., Murata M., Nakamura M., Ninomiya N., Nishiyori H., Nomura K.,
RA   Ohno M., Sakazume N., Sano H., Sasaki D., Shibata K., Shiraki T.,
RA   Tagami M., Tagami Y., Waki K., Watahiki A., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (14-APR-2004) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science, e1252229 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science, e1252229 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; ef57b6cb660cab263e9c5474ebd56a60.
DR   Ensembl-Gn; ENSMUSG00000003228; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0025299; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0025275; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0025244; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0025270; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0025030; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025713; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0024495; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0025010; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0025142; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0025103; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0025228; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0025136; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025771; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0024243; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024565; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000003313; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0052292; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0052299; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0052248; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0052245; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0051978; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0052730; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0052132; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0051924; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0052028; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0051986; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0052146; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0051980; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0052864; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0051737; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0051259; mus_musculus_wsbeij.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=6030478C10
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2645
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /sex="male"
FT                   /dev_stage="13 days embryo"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="6030478C10"
FT                   /tissue_type="testis"
FT                   /db_xref="taxon:10090"
FT   CDS             312..2084
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="G protein-coupled receptor kinase 5 (MGD|MGI:109161
FT                   GB|NM_018869, evidence: BLASTN, 99%, match=2227)"
FT                   /note="putative"
FT                   /db_xref="GOA:Q3TST4"
FT                   /db_xref="InterPro:IPR000239"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR000961"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR016137"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="MGI:MGI:109161"
FT                   /db_xref="UniProtKB/TrEMBL:Q3TST4"
FT                   /protein_id="BAE36591.1"
FT                   /translation="MELENIVANTVLLKAREGGGGKRKGKSKKWKEILKFPHISQCEDL
FT                   RRTIDRDYYSLCDKQPIGRLLFRQFCETRPGLECYIQFLDLVAEYEITPDENLGAKGKE
FT                   IMTKYLTPKSPVFIAQVGQDLVSQTEKKLLQSPCKELFSACAQSVHDYLKGDPFHEYLD
FT                   SMYFDRFLQWKWLERQPVTKNTFRQYRVLGKGGFGEVCACQVRATGKMYACKRLEKKRI
FT                   KKRKGESMALNEKQILEKVNSQFVVNLAYAYETKDALCLVLTIMNGGDLKFHIYNMGNP
FT                   GFEEERALFYAAEILCGLEDLHRENTVYRDLKPENILLDDYGHIRISDLGLAVKIPEGD
FT                   LIRGRVGTVGYMAPEVLNNQRYGLSPDYWGLGCLIYEMIEGQSPFRGRKEKVKREEVDR
FT                   RVLETEEVYSSKFSEEAKSICNMLLTKDSKQRLGCQEEGAAEVKRHPFFRNMNFKRLEA
FT                   GMLDPPFVPDPRAVYCKDVLDIEQFSTVKGVNLDHTDDDFYSKFSTGSVPIPWQNEMIE
FT                   TECFKELNVFGPNGTLSPDLNRSQPPEPPKKGLFHRLFRRQHQSNSKSSPTPKTSCNHR
FT                   INSNHINSNSTGSS"
XX
SQ   Sequence 2645 BP; 727 A; 595 C; 719 G; 601 T; 3 other;
     aaagcatccg agggagccgg aggggagtag aatggagtga cagagacgcg cggagggtgg        60
     ggggtggggg ggaaagtgtt gagggagggg ggaggnnnaa cacagaggga ggaagaagcg       120
     gcggcggcgt ctcttcggtg cagaggggga aactccgcgg gctccgagaa agaataatgc       180
     ggtagcaggc aggctgcttg ctctggggtt tggcagcagc ggcggcagct cgagcagtgg       240
     cagcggcagc ggcatcaccc cagacgctga cagcacagcc ggccggctcc ctcgctgact       300
     gccgactgtc aatggagctg gaaaacatcg tggccaacac ggtcttgctg aaagcccggg       360
     aagggggtgg aggaaagcgc aaagggaaaa gcaagaagtg gaaggaaatc ctgaagtttc       420
     ctcacatcag ccagtgtgaa gacctccgaa ggaccataga cagagattac tacagtctat       480
     gtgacaagca accaattggg agactgcttt ttcgacagtt ctgtgaaacc aggcctgggc       540
     tggagtgcta cattcagttc ctggacttag tggcagaata tgaaattact ccagatgaaa       600
     accttggggc gaaggggaag gaaataatga ccaagtacct cactccaaag tccccagtct       660
     tcattgccca agttggacag gacctggtct cccagacaga gaagaagctc ctgcagagcc       720
     cctgcaaaga actcttctct gcttgtgctc agtctgtcca tgactacttg aagggagacc       780
     ccttccacga gtacctggat agcatgtatt ttgaccgttt tctgcagtgg aaatggttag       840
     aaagacaacc agtgaccaaa aacactttcc ggcagtaccg agtgctgggc aaagggggct       900
     ttggagaggt ctgtgcctgc caggttcggg ccactggtaa aatgtatgct tgtaaacgct       960
     tagagaagaa gaggatcaaa aagaggaaag gcgaatccat ggcactcaac gaaaagcaga      1020
     ttcttgagaa ggtcaacagc cagtttgtgg tcaacctggc ctatgcctat gaaaccaaag      1080
     atgcactatg cctggttctg accattatga atggtggtga cctgaagttt cacatctaca      1140
     atatggggaa tcctggcttt gaggaagagc gagccttatt ttatgcagct gagatcctct      1200
     gtggcctaga agacttacac cgtgagaaca ctgtctatag agatctaaaa cccgaaaaca      1260
     tcttgctgga tgattatggc cacataagga tctcagacct cggactggcc gtgaagatcc      1320
     ccgagggaga ccttatccgt ggccgggtag gcactgttgg ctacatggcc ccagaagttc      1380
     tgaacaacca gcgatatgga ctgagccctg actactgggg cctgggctgc ctcatctatg      1440
     agatgattga aggccagtca ccatttcgag gtcgcaagga gaaggttaag cgggaagagg      1500
     tggatcgccg ggtgctggag actgaggaag tgtattcctc caagttctct gaagaggcca      1560
     agtccatctg caacatgctg ctcaccaaag actcgaagca gaggctgggc tgccaggagg      1620
     agggggccgc cgaggtcaag aggcaccctt tcttcaggaa catgaacttt aagcgcctgg      1680
     aggctgggat gttggaccct cccttcgttc cagatccccg ggctgtatac tgcaaggatg      1740
     tgctggacat tgagcagttc tccactgtga aaggtgtcaa cctggaccat acggacgatg      1800
     atttttactc aaagttctct acaggctctg tgccaattcc atggcaaaat gagatgatag      1860
     aaacagaatg tttcaaggag ctgaatgtgt tcggacctaa cggtaccctc tcaccagacc      1920
     tgaacagaag tcagcctcca gaaccgccaa agaaagggct gttccacaga ctcttcaggc      1980
     gtcagcatca aagcaattcc aagagttcac ctactcctaa gaccagttgt aaccaccgaa      2040
     taaattcaaa ccacatcaat tcaaactcca ctggaagcag ctagtttcgg ctctggcctt      2100
     gaagtcaaaa gtggaaccag ctcagagcct tctacttgga agcagaactt gtagccaggg      2160
     gagcttccac tgtggctcag tggccagcaa agctccagtg ggaactaaga taggagaccg      2220
     ttcccccaat aacaaacctc caagtttctc aaagaaattt ccactcaggt ctgttttcca      2280
     aggtggcccc aagctggggt ggactagaat tttccttgtt gaacattgca atagaaaccc      2340
     aatgggatat gacagcttgc acggatttta atagcatcct aactagaact gaattttgtc      2400
     tttattattt ttaaaggaaa gttttgtaaa tttctctatt gtctctgttt acattttgta      2460
     tatttgtatt taagtgaaag tcagactttg agggtgtata ttttctgtgc agccactgtt      2520
     aagccatgtg ttttaagaca ttttagattg gagggggggt tacaaaaatg tgactctaga      2580
     cttccagagc ctcaaaagag ataatgtttt tattaaatat agaaaatatc tcacttttta      2640
     ccttt                                                                  2645
//