spacer

EBI Dbfetch

ID   AK161525; SV 1; linear; mRNA; HTC; MUS; 2031 BP.
XX
AC   AK161525;
XX
DT   09-SEP-2005 (Rel. 85, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 10)
XX
DE   Mus musculus 11 days pregnant adult female ovary and uterus cDNA, RIKEN
DE   full-length enriched library, clone:5031410H14 product:caspase 12, full
DE   insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2031
RA   Arakawa T., Carninci P., Fukuda S., Hashizume W., Hayashida K., Hori F.,
RA   Iida J., Imamura K., Imotani K., Itoh M., Kanagawa S., Kawai J., Kojima M.,
RA   Konno H., Murata M., Nakamura M., Ninomiya N., Nishiyori H., Nomura K.,
RA   Ohno M., Sakazume N., Sano H., Sasaki D., Shibata K., Shiraki T.,
RA   Tagami M., Tagami Y., Waki K., Watahiki A., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (14-APR-2004) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; cf489e2874337acb39c2c8ebe72ea102.
DR   Ensembl-Gn; ENSMUSG00000025887; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000027009; mus_musculus.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=5031410H14
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2031
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /sex="female"
FT                   /dev_stage="11 days pregnant adult"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="5031410H14"
FT                   /tissue_type="ovary and uterus"
FT                   /db_xref="taxon:10090"
FT   CDS             30..1289
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="caspase 12 (MGD|MGI:1312922 GB|BC028979, evidence:
FT                   BLASTN, 100%, match=2030)"
FT                   /note="putative"
FT                   /db_xref="GOA:O08736"
FT                   /db_xref="InterPro:IPR001309"
FT                   /db_xref="InterPro:IPR001315"
FT                   /db_xref="InterPro:IPR002138"
FT                   /db_xref="InterPro:IPR011029"
FT                   /db_xref="InterPro:IPR011600"
FT                   /db_xref="InterPro:IPR015917"
FT                   /db_xref="InterPro:IPR016129"
FT                   /db_xref="InterPro:IPR017350"
FT                   /db_xref="InterPro:IPR029030"
FT                   /db_xref="MGI:MGI:1312922"
FT                   /db_xref="UniProtKB/Swiss-Prot:O08736"
FT                   /protein_id="BAE36443.1"
FT                   /translation="MAARRTHERDPIYKIKGLAKDMLDGVFDDLVEKNVLNGDELLKIG
FT                   ESASFILNKAENLVENFLEKTDMAGKIFAGHIANSQEQLSLQFSNDEDDGPQKICTPSS
FT                   PSESKRKVEDDEMEVNAGLAHESHLMLTAPHGLQSSEVQDTLKLCPRDQFCKIKTERAK
FT                   EIYPVMEKEGRTRLALIICNKKFDYLFDRDNADTDILNMQELLENLGYSVVLKENLTAQ
FT                   EMETELMQFAGRPEHQSSDSTFLVFMSHGILEGICGVKHRNKKPDVLHDDTIFKIFNNS
FT                   NCRSLRNKPKILIMQACRGRYNGTIWVSTNKGIATADTDEERVLSCKWNNSITKAHVET
FT                   DFIAFKSSTPHNISWKVGKTGSLFISKLIDCFKKYCWCYHLEEIFRKVQHSFEVPGELT
FT                   QMPTIERVSMTRYFYLFPGN"
FT   polyA_signal    2016..2021
FT                   /note="putative"
FT   polyA_site      2031
FT                   /note="putative"
XX
SQ   Sequence 2031 BP; 674 A; 365 C; 405 G; 587 T; 0 other;
     ttttttatgt ccaggagtcc tgcacagcca tggcggccag gaggacacat gaaagagatc        60
     caatctacaa gatcaaaggt ttggccaagg acatgctgga tggggttttt gatgacctgg       120
     tggagaagaa tgttttaaat ggagatgagt tactcaaaat aggggaaagt gcgagtttca       180
     tcctgaacaa ggctgagaat ctggttgaga acttcttaga gaaaacagac atggcaggaa       240
     aaatatttgc tggccacatt gccaattccc aggaacagct gagtttacaa ttttctaatg       300
     atgaggatga tggacctcag aagatatgta caccttcttc tccatcagaa tccaagagaa       360
     aagtagagga tgatgaaatg gaggtaaatg ctggattggc ccatgaatca catctaatgc       420
     tgacagctcc tcatggactc cagagctcag aagtccaaga tacactgaag ctttgtccac       480
     gtgatcagtt ttgtaagata aagacagaaa gggcaaaaga gatatatcca gtgatggaga       540
     aggagggacg aacacgtctg gctctcatca tctgcaacaa aaagtttgac tacctttttg       600
     atagagataa tgctgatact gacattttga acatgcaaga actacttgaa aatcttggat       660
     actctgtggt gttaaaggaa aaccttacag ctcaggaaat ggagacagag ttaatgcagt       720
     ttgctggccg tccagagcac cagtcctcag acagcacatt cctggtgttt atgtcccatg       780
     gcatcctgga aggaatctgt ggggtgaagc accgaaacaa aaagccagat gttcttcatg       840
     atgacactat cttcaaaatt ttcaacaact ctaactgtcg gagtctgaga aacaaaccca       900
     agattctcat catgcaggcc tgcagaggca gatataatgg aactatttgg gtatccacaa       960
     acaaagggat agccactgct gatacagatg aggaacgtgt gttgagctgt aaatggaata      1020
     atagtataac aaaggcccat gtggagacag atttcattgc tttcaaatct tctaccccac      1080
     ataatatttc ttggaaggta ggcaagactg gttccctctt catttccaaa ctcattgact      1140
     gcttcaaaaa gtactgttgg tgttatcatt tggaggaaat ttttcgaaag gttcaacact      1200
     catttgaggt cccaggtgaa ctgacccaga tgcccactat tgagagagta tccatgacac      1260
     gctatttcta cctttttccc gggaattagc acaggcaact ctcatgcagt tcccagtcaa      1320
     gtattgctgt agctgagaag aaaagaaaat tccaagatcc caggattttt aaatgtgtaa      1380
     aacttttcag ttagatattt tatacaatat cataaggcta gataatttcc ataggttatt      1440
     tttaggggaa acctgatacg taaaattttg catgaaaagt atagattcgt tccttccttc      1500
     caaatctgct catcttttac tttattttat taaatttata tttgcacatt tttgtaaaat      1560
     gaataaagga aaaagacact aaagaacatg tctgaacata tcctggaact tcttctttgt      1620
     aaaatgaata aaggaaaaag acactaaaga acaaagatga tacacctttt gatgaaccac      1680
     tttcacctat aaattagtag taagaattta ctcacaagga agatcttatc tacaatgtag      1740
     ctgagaaatg aaactgttgc atatgtaggt aaaactaatc atcttttagg aataagataa      1800
     agaggtttat gtccactgtt tgtctctggc atacatggtt ttcatgccta gtggctacct      1860
     accattcctt tcaatcaatt tcttaggata taattgacaa atttatgcta tgtttataat      1920
     ttttctctta aatgcttttg taataagata tactcacaca tacacattta agattctgtc      1980
     tattagtgtt attgaaataa atcctagaaa caaaaattaa aagtttaaag c               2031
//


spacer
spacer