Dbfetch

ID   AK161294; SV 1; linear; mRNA; HTC; MUS; 2442 BP.
XX
AC   AK161294;
XX
DT   09-SEP-2005 (Rel. 85, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 10)
XX
DE   Mus musculus adult male testis cDNA, RIKEN full-length enriched library,
DE   clone:4922505I01 product:AXL receptor tyrosine kinase, full insert
DE   sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2442
RA   Arakawa T., Carninci P., Fukuda S., Hashizume W., Hayashida K., Hori F.,
RA   Iida J., Imamura K., Imotani K., Itoh M., Kanagawa S., Kawai J., Kojima M.,
RA   Konno H., Murata M., Nakamura M., Ninomiya N., Nishiyori H., Nomura K.,
RA   Ohno M., Sakazume N., Sano H., Sasaki D., Shibata K., Shiraki T.,
RA   Tagami M., Tagami Y., Waki K., Watahiki A., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (14-APR-2004) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science, e1252229 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science, e1252229 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; dd4a8a190f8daa42d203b98a38552ed7.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=4922505I01
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2442
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /sex="male"
FT                   /dev_stage="adult"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="4922505I01"
FT                   /tissue_type="testis"
FT                   /db_xref="taxon:10090"
FT   CDS             <1..1595
FT                   /codon_start=3
FT                   /transl_table=1
FT                   /note="AXL receptor tyrosine kinase (MGD|MGI:1347244
FT                   GB|NM_009465, evidence: BLASTN, 100%, match=2442)"
FT                   /note="putative"
FT                   /note="start codon is not identified"
FT                   /db_xref="GOA:Q3TTM4"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR001245"
FT                   /db_xref="InterPro:IPR003961"
FT                   /db_xref="InterPro:IPR008266"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR020635"
FT                   /db_xref="InterPro:IPR036116"
FT                   /db_xref="MGI:MGI:1347244"
FT                   /db_xref="UniProtKB/TrEMBL:Q3TTM4"
FT                   /protein_id="BAE36301.1"
FT                   /translation="LGYRLAYRGQDTPEVLMDIGLTREVTLELRGDRPVANLTVSVTAY
FT                   TSAGDGPWSLPVPLEPWRPGQGQPLHHLVSEPPPRAFSWPWWYVLLGALVAAACVLILA
FT                   LFLVHRRKKETRYGEVFEPTVERGELVVRYRVRKSYSRRTTEATLNSLGISEELKEKLR
FT                   DVMVDRHKVALGKTLGEGEFGAVMEGQLNQDDSILKVAVKTMKIAICTRSELEDFLSEA
FT                   VCMKEFDHPNVMRLIGVCFQGSDREGFPEPVVILPFMKHGDLHSFLLYSRLGDQPVFLP
FT                   TQMLVKFMADIASGMEYLSTKRFIHRDLAARNCMLNENMSVCVADFGLSKKIYNGDYYR
FT                   QGRIAKMPVKWIAIESLADRVYTSKSDVWSFGVTMWEIATRGQTPYPGVENSEIYDYLR
FT                   QGNRLKQPVDCLDGLYALMSRCWELNPRDRPSFAELREDLENTLKALPPAQEPDEILYV
FT                   NMDEGGSHLEPRGAAGGADPPTQPDPKDSCSCLTAADVHSAGRYVLCPSTAPGPTLSAD
FT                   RGCPAPPGQEDGA"
FT   regulatory      2425..2430
FT                   /note="putative"
FT                   /regulatory_class="polyA_signal_sequence"
FT   polyA_site      2442
FT                   /note="putative"
XX
SQ   Sequence 2442 BP; 571 A; 626 C; 639 G; 606 T; 0 other;
     tgttagggta ccggctggca tatcgaggcc aggacacccc cgaggtactt atggatatag        60
     ggctaactcg agaggtgacc ttggaactgc ggggggacag gcctgtggct aacctgactg       120
     tgtctgtgac agcctatacc tcggctgggg atgggccctg gagccttcct gtgcccctag       180
     agccctggcg cccagggcaa ggacagccac tccaccatct ggtgagtgaa cccccacctc       240
     gcgccttctc gtggccttgg tggtatgtac tgctgggagc acttgtggct gccgcctgcg       300
     tcctcatctt ggccctgttc cttgtccatc ggaggaagaa ggagactcga tatggggagg       360
     tgtttgagcc aaccgtggaa agaggtgaac tggtagtcag gtaccgtgtc cgaaagtcct       420
     acagccggcg gaccactgaa gccaccttga acagtctggg catcagtgaa gagctgaagg       480
     agaaactacg agacgtcatg gtagatcggc ataaggtggc cttggggaag accctgggag       540
     aaggagaatt tggcgctgtg atggaaggtc agctcaatca ggatgactcc atcctcaagg       600
     tcgctgtgaa gaccatgaaa attgccatct gcacaagatc agagctggag gatttcctga       660
     gtgaagctgt ctgcatgaag gaatttgacc accccaacgt catgaggctc attggcgtct       720
     gttttcaggg ctctgacaga gagggtttcc cagaacctgt ggtcatcttg cctttcatga       780
     aacacggaga cctacacagt ttcctcctgt actcccggct cggggaccag ccagtgttcc       840
     tgcccactca gatgctagtg aagttcatgg ccgacattgc cagtggtatg gagtacctga       900
     gtaccaagag attcatacat cgggacctgg ctgccaggaa ctgcatgctg aatgagaaca       960
     tgtccgtgtg tgtggcagac ttcgggctct ccaagaagat ctacaacggg gattactacc      1020
     gccaagggcg cattgccaag atgccagtca agtggattgc tattgagagt ctggcagatc      1080
     gggtctacac cagcaagagc gatgtgtggt ccttcggtgt gacaatgtgg gagatcgcca      1140
     cccgaggcca aactccctat ccaggggtgg agaacagtga gatttacgac tacctgcgtc      1200
     aaggaaatcg gctgaaacag cctgtggact gtctggacgg cctgtatgcc ctgatgtctc      1260
     ggtgctggga actgaaccct cgagaccggc caagttttgc ggagctccgg gaagacttgg      1320
     agaacacact gaaggctctg ccccctgctc aggagccaga tgaaatcctc tatgtcaaca      1380
     tggatgaggg cggaagccac cttgaacccc gtggggctgc tggaggagct gaccccccaa      1440
     cccaacctga tcctaaggat tcctgtagct gtctcactgc agctgacgtc cactcagctg      1500
     gacgctatgt cctttgtcct tctacagccc caggacccac tctgtctgct gacagaggct      1560
     gcccagcacc tccagggcag gaggacggag cctgagacaa tcttccacct gggacatcct      1620
     ctcaggaccc aagctaggca ctgccactgg gggaaagctc acccccccac tccgtcactc      1680
     caggccttct ccccagatgc agaatggcct tccctccctt ctcagatgca gtccatgcct      1740
     tatgcaccct atccataaca gtttcaaggg atcgtctcac atcttccatc ccagcgttct      1800
     agattttaag gtttgagttt agagttcaaa gttctcaaag atgatgagtc tttggaccga      1860
     gatgcttgtt tctaggtctg cagcgctgtt gctatagaca ggcccactgc tcgaaggctc      1920
     tgagattcta tggctctaga tttttctggc tctataattc gtggcaatgc tcccatggtt      1980
     ttaggttgca cgactctgag attccaggac ctaaggcttc tagactttat ttttctggag      2040
     ccaggggtcc tgtcagtgga agattgtaga tttttaaatt ctaaagattc taggcatgaa      2100
     ggttctaagg catactgctt ctccagttta acagtttagg gctcatgttg gaatactcca      2160
     gatcataatg tttcaaactt ttattttttt taatttctaa gaccccagtg atggtcaact      2220
     acagattctg aagccttatg accatagatt cttttatata aaaatcctgt atctcaagga      2280
     aatatgattc tagactctga aattccaaag ctttaagagt ctccagatgg agtttctaag      2340
     ctatgatgtg gtgataatct aaagtttagt ccaaggttct agattcctaa gcttccacgt      2400
     catctgctcc caggattcca gattattaaa ctctaaaact ct                         2442
//