spacer

EBI Dbfetch

ID   AK161030; SV 1; linear; mRNA; HTC; MUS; 2713 BP.
XX
AC   AK161030;
XX
DT   09-SEP-2005 (Rel. 85, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 10)
XX
DE   Mus musculus 14 days embryo liver cDNA, RIKEN full-length enriched library,
DE   clone:4432409A07 product:transient receptor potential cation channel,
DE   subfamily M, member 5, full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2713
RA   Arakawa T., Carninci P., Fukuda S., Hashizume W., Hayashida K., Hori F.,
RA   Iida J., Imamura K., Imotani K., Itoh M., Kanagawa S., Kawai J., Kojima M.,
RA   Konno H., Murata M., Nakamura M., Ninomiya N., Nishiyori H., Nomura K.,
RA   Ohno M., Sakazume N., Sano H., Sasaki D., Shibata K., Shiraki T.,
RA   Tagami M., Tagami Y., Waki K., Watahiki A., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (14-APR-2004) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; 724743f4e00fafa941d75d922134fa3a.
DR   Ensembl-Gn; ENSMUSG00000009246; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000009390; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000150867; mus_musculus.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=4432409A07
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2713
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /dev_stage="14 days embryo"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="4432409A07"
FT                   /tissue_type="liver"
FT                   /db_xref="taxon:10090"
FT   CDS             <1..2157
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="putative"
FT                   /note="start codon is not identified"
FT                   /note="transient receptor potential cation channel,
FT                   subfamily M, member 5 (MGD|MGI:1861718 GB|AB039952,
FT                   evidence: BLASTN, 99%, match=2711)"
FT                   /db_xref="GOA:Q9JJH7"
FT                   /db_xref="InterPro:IPR029577"
FT                   /db_xref="MGI:MGI:1861718"
FT                   /protein_id="BAE36157.1"
FT                   /translation="EGRLTLAGLGAQQARELPIGLPAFSLHEVSRVLKDFLHDACRGFY
FT                   QDGRRMEERGPPKRPAGQKWLPDLSRKSEDPWRDLFLWAVLQNRYEMATYFWAMGREGV
FT                   AAALAACKIIKEMSHLEKEAEVARTMREAKYEQLALDLFSECYGNSEDRAFALLVRRNH
FT                   SWSRTTCLHLATEADAKAFFAHDGVQAFLTKIWWGDMATGTPILRLLGAFTCPALIYTN
FT                   LISFSEDAPQRMDLEDLQEPDSLDMEKSFLCSRGGQLEKLTEAPRAPGDLGPQAAFLLT
FT                   RWRKFWGAPVTVFLGNVVMYFAFLFLFTYVLLVDFRPPPQGPSGSEVTLYFWVFTLVLE
FT                   EIRQGFFTDEDTHLVKKFTLYVEDNWNKCDMVAIFLFIVGVTCRMVPSVFEAGRTVLAI
FT                   DFMVFTLRLIHIFAIHKQLGPKIIIVERMMKEVFFFLFFLSVWLVAYGVTTQALLHPHD
FT                   GRLEWIFRRVLYRPYLQIFGQIPLDEIDEARVNCSLHPLLLESSASCPNLYANWLVILL
FT                   LVTFLLVTNVLLMNLLIAMFSYTFQVVQGNADMFWKFQRYHLIVEYHGRPALAPPFILL
FT                   SHLSLVLKQVFRKEAQHKRQHLERDLPDPLDQKIITWETVQKENFLSTMEKRRRDSEGE
FT                   VLRKTAHRVDLIAKYIGGLREQEKRIKCLESQANYCMLLLSSMTDTLAPGGTYSSSQNC
FT                   GCRSQPASARDREYLESGLPPSDT"
XX
SQ   Sequence 2713 BP; 605 A; 758 C; 713 G; 637 T; 0 other;
     gagggtaggc tgacactggc cggcctgggt gcccagcagg ctcgggagct gcccattggt        60
     ctgcctgcct tctcactcca cgaggtctcc cgcgtactca aagacttcct gcatgacgcc       120
     tgccgtggct tctaccagga cgggcgcagg atggaggaga gagggccacc taagcggccc       180
     gcaggccaga agtggctgcc agacctcagt aggaagagtg aagacccttg gagggacctg       240
     ttcctctggg ctgtgctgca gaatcgttat gagatggcca catacttctg ggccatgggc       300
     cgggagggtg tggctgctgc tctggctgcc tgcaagatca taaaggaaat gtcccacctg       360
     gagaaagagg cagaggtggc ccgcaccatg cgtgaggcca agtatgagca gctggccctg       420
     gatcttttct cagagtgcta cggcaacagt gaggaccgtg cctttgccct gctggtgcga       480
     aggaaccaca gctggagcag gaccacgtgc ctgcacctgg ccactgaagc tgatgccaag       540
     gccttctttg cccatgacgg tgtgcaagca ttcctgacca agatctggtg gggagacatg       600
     gccacaggca cacccatcct acggcttctg ggtgccttca cctgcccagc cctcatctac       660
     acaaacctca tctccttcag tgaggatgcc ccgcagagga tggacctaga agatctgcag       720
     gagccagaca gcttggatat ggaaaagagc ttcctatgca gccggggtgg ccaattggag       780
     aagctaacag aggcaccaag ggctccaggc gatctaggcc cacaagctgc cttcctgctc       840
     acacggtgga ggaagttctg gggcgctcct gtgactgtgt tcctggggaa tgtggtcatg       900
     tacttcgcat tcctcttcct gttcacctat gtcctgctgg tggacttcag gccaccaccc       960
     caggggccgt ctggatccga ggttaccctc tatttctggg tgttcacact ggtgctggag      1020
     gaaatccgac agggcttctt cacagatgag gacacgcacc tggtgaagaa attcactctg      1080
     tatgtggaag acaactggaa caagtgtgac atggtggcca tcttcctgtt cattgtggga      1140
     gtcacctgta gaatggtgcc ctcggtgttt gaggctggca ggaccgttct ggccattgac      1200
     ttcatggtgt tcacacttcg gctcatccac atctttgcta ttcacaagca gttgggtcct      1260
     aagatcatca ttgtagagcg aatgatgaag gaagtcttct ttttcctctt cttcctgagc      1320
     gtatggcttg tggcctatgg tgtgaccact caggccctgc tgcatcccca tgatggccgt      1380
     ttggagtgga ttttccgccg tgtgctatac aggccttacc tgcagatctt tgggcaaatc      1440
     cctctggatg aaattgatga ggctcgtgtg aactgttctc ttcaccctct gctgctggaa      1500
     agctcggctt cctgccctaa tctctatgcc aactggctgg tcattctcct gctggttacc      1560
     ttcctgcttg tcactaatgt gctgctcatg aaccttctga tcgccatgtt cagctacaca      1620
     ttccaggtgg tgcaaggcaa tgcagacatg ttctggaagt ttcaacgcta ccacctcatc      1680
     gttgaatacc atggaagacc agctctggcc ccgcccttca tcctgctcag ccacctgagc      1740
     ctggtgctca agcaggtctt caggaaggaa gcccagcata agcgacaaca tctggagaga      1800
     gacttgcctg accccttgga ccagaagatc attacctggg aaacggttca aaaggagaac      1860
     ttcctgagta ccatggagaa acggaggagg gacagcgagg gggaggtgct gaggaaaacg      1920
     gcacacagag tggacttgat tgccaaatac atcggggggc tgagagagca agaaaagagg      1980
     atcaagtgtc tggaatcaca ggccaactac tgtatgctcc tcttgtcctc tatgacggat      2040
     acactggctc caggaggcac ctactcaagc tctcagaact gtggttgcag gagtcagcca      2100
     gcctctgcta gagacaggga gtacctagag tctggcttgc caccctctga cacctgaaat      2160
     ggagaaacca cttgctctag agccccagac ctggccacat cgagtttttg gggcacatca      2220
     accttccccc actcccagca gccccaagaa atggtcttca aggccttgct acagatcact      2280
     tcttggacat cccttcctaa gagaatgaaa ctcatgtctt tggcatctat tcgggagcct      2340
     cagaagtatc ctctccagca gggcaagatt tttcatgtcc cactaaagct ttcactggct      2400
     tggactggac agctggatct ggccaagtcc tacataggac accatctgcc tggatggggc      2460
     tatttaggtc taacccctgt cttaccctga gttcctaaga agccaacctc ttaaacacta      2520
     ggtttctttc tgacccctga cccactcatt agctgaccag ctcctagagg gcaggactca      2580
     gatctattgt aattacctcc catctttcac cccccacagc attatctgtc tgatcattct      2640
     ggcagaaacc ccaagatatt gctcaagggt acccaatgct actttacttt ctataaagcc      2700
     tgtagaccac ccc                                                         2713
//


spacer
spacer