spacer

EBI Dbfetch

ID   AK160925; SV 1; linear; mRNA; HTC; MUS; 1829 BP.
XX
AC   AK160925;
XX
DT   09-SEP-2005 (Rel. 85, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 10)
XX
DE   Mus musculus 18 days pregnant adult female placenta and extra embryonic
DE   tissue cDNA, RIKEN full-length enriched library, clone:3830429G04
DE   product:vesicle-associated membrane protein, associated protein B and C,
DE   full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1829
RA   Arakawa T., Carninci P., Fukuda S., Hashizume W., Hayashida K., Hori F.,
RA   Iida J., Imamura K., Imotani K., Itoh M., Kanagawa S., Kawai J., Kojima M.,
RA   Konno H., Murata M., Nakamura M., Ninomiya N., Nishiyori H., Nomura K.,
RA   Ohno M., Sakazume N., Sano H., Sasaki D., Shibata K., Shiraki T.,
RA   Tagami M., Tagami Y., Waki K., Watahiki A., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (14-APR-2004) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; ef64346cecc7f36baa07cd5e2e1c377f.
DR   Ensembl-Gn; ENSMUSG00000054455; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000067530; mus_musculus.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=3830429G04
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1829
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /sex="female"
FT                   /dev_stage="18 days pregnant adult"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="3830429G04"
FT                   /tissue_type="placenta and extra embryonic tissue"
FT                   /db_xref="taxon:10090"
FT   CDS             <1..697
FT                   /codon_start=2
FT                   /transl_table=1
FT                   /note="putative"
FT                   /note="start codon is not identified"
FT                   /note="vesicle-associated membrane protein, associated
FT                   protein B and C (MGD|MGI:1928744 GB|NM_019806, evidence:
FT                   BLASTN, 99%, match=1827)"
FT                   /db_xref="GOA:Q3TU78"
FT                   /db_xref="InterPro:IPR000535"
FT                   /db_xref="InterPro:IPR008962"
FT                   /db_xref="InterPro:IPR016763"
FT                   /db_xref="MGI:MGI:1928744"
FT                   /db_xref="UniProtKB/TrEMBL:Q3TU78"
FT                   /protein_id="BAE36093.1"
FT                   /translation="QHELKFRGPFTDVVTTNLKLGNPTDRNVCFKVKTTAPRRYCVRPN
FT                   SGVIDAGASLNVSVMLQPFDYDPNEKSKHKFMVQSMFAPPDTSDMEAVWKEAKPEDLMD
FT                   SKLRCVFELPAENAKPHDVEINKIIPTSASKTEAPAAAKSLTSPLDDTEVKKVMEECRR
FT                   LQGEVQRLREESRQLKEEDGLRVRKAMPSNSPVAALAATGKEEGLSARLLALVVLFFIV
FT                   GVIIGKIAL"
FT   polyA_signal    1814..1819
FT                   /note="putative"
FT   polyA_site      1829
FT                   /note="putative"
XX
SQ   Sequence 1829 BP; 471 A; 416 C; 519 G; 423 T; 0 other;
     acaacacgag ctcaagttcc gaggtccctt cactgatgtt gtcaccacca acctaaagct        60
     tggcaaccca acagaccgaa atgtgtgttt taaagtgaag accacagcac ctcgcaggta       120
     ctgcgtgcgg cccaacagtg gggtcattga tgccggggcc tctctcaatg tgtctgtgat       180
     gttacagcct ttcgattatg atcccaatga gaaaagtaaa cacaagttta tggttcagtc       240
     tatgtttgct ccgcctgaca cttctgatat ggaggcagta tggaaggagg caaaaccgga       300
     agaccttatg gattcaaaac ttagatgtgt gtttgaattg ccagcagaaa atgctaaacc       360
     acatgatgta gaaataaata aaatcatacc tacgagtgca tccaagacag aagcaccggc       420
     agccgcaaag tccctgacat cgcccctcga tgacacagaa gtaaagaagg tgatggaaga       480
     gtgcaggcgg ctgcaggggg aggtgcagag gcttcgggag gagagcaggc agctcaagga       540
     agaagacgga cttcgggtga ggaaggcgat gccgagcaac agccccgtgg cggctctggc       600
     ggccactggg aaggaggagg gcctgagcgc ccggctgctg gccctggtgg ttctgttctt       660
     tatcgttggt gtcattatag ggaagattgc cttgtagggg ccgcatgcga aggatggcag       720
     gttggattga tggatctacc acaccatggg attcaaattt atcataacca tgcgtaaaaa       780
     gaaattaatg tatgacggca tctcacaggt cttgccttta aatacccctc cccatgcaca       840
     cacaaatgca cacacaaata tagcataata taatgatctt ttagaaagtt aaaaatgtat       900
     agggaatgga tggggaaaga atggtctgtt gccgtaggac gggccgtgat taaccacagt       960
     ggcatcttgt agctgtcacg ctcaattcgg gtaggcctgg gcacgtgttg ctagatcact      1020
     ctcttaaagc aagaagctcc tcctcgcatg ttggggctgg cccgtgggag cgggagtcct      1080
     gcaaggtggg gcgagatgtc tttttcttac ccacgtggct tccccaggcc tgctgttctg      1140
     tccaggcatc gtctcctcag gcctacagag ctgcaggtgc caaagtgcat tgcacagagg      1200
     ccacatctcg tgtacctgtg ggtcgtgtgg gagagacatg agtggaccag cgggtccaac      1260
     acagggaaat ccaagtctgt gctctgttct cttgaaggga ccaagctaaa ttaccgctgg      1320
     ttcaagtagt gaaccgagtt gttctcggag atggctgatg cacatgtaac ctatttcatc      1380
     tcgtgtgttc ctgctgccac cagagcacag gcagtgagtg ctgcagaccg ccagtgagga      1440
     gctgctgctg tgggctctgg aggtctgagg gaaggggagg gtctgagtca ggaagtgttt      1500
     tgttgtaggt cagtaatagc tgccctgagg aggaacgctc tttttaatga cagtcagctc      1560
     tggattaccc agtcttctag attgccctac catccatcct tctaaaacat aggccagcct      1620
     tgacctgccc ttctcaggat gagtgagtca ggctgcagag ggtgaagggc atagaggggg      1680
     tggggtgggg tgggggagcc ctcagcaaat ccatctgcag gtgatgaaga gtcctgactg      1740
     tgaattaatt tcatgccata aaagaccgat ccagttctgc tcaactatgt agcatcttaa      1800
     aggaagagat taaaataaag ccccaaact                                        1829
//


spacer
spacer