Dbfetch

ID   AK160915; SV 1; linear; mRNA; HTC; MUS; 1934 BP.
XX
AC   AK160915;
XX
DT   09-SEP-2005 (Rel. 85, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 10)
XX
DE   Mus musculus 18 days pregnant adult female placenta and extra embryonic
DE   tissue cDNA, RIKEN full-length enriched library, clone:3830418A02
DE   product:activin A receptor, type II-like 1, full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1934
RA   Arakawa T., Carninci P., Fukuda S., Hashizume W., Hayashida K., Hori F.,
RA   Iida J., Imamura K., Imotani K., Itoh M., Kanagawa S., Kawai J., Kojima M.,
RA   Konno H., Murata M., Nakamura M., Ninomiya N., Nishiyori H., Nomura K.,
RA   Ohno M., Sakazume N., Sano H., Sasaki D., Shibata K., Shiraki T.,
RA   Tagami M., Tagami Y., Waki K., Watahiki A., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (14-APR-2004) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science, e1252229 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science, e1252229 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; d177440b32f3fbeb424afc2eb770ef6d.
DR   Ensembl-Gn; ENSMUSG00000000530; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0022365; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0022327; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0022303; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0022331; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0022101; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0022779; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0021626; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0022070; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0022197; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0022176; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0022268; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0022197; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0022793; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0021365; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0021676; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000000542; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000117984; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000119063; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000120028; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000120754; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000121718; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0042672; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0042634; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0042598; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0042624; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0042361; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0043109; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0042462; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0042275; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0042425; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0042390; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0042499; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0042370; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0043148; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0042043; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0041752; mus_musculus_wsbeij.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=3830418A02
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1934
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /sex="female"
FT                   /dev_stage="18 days pregnant adult"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="3830418A02"
FT                   /tissue_type="placenta and extra embryonic tissue"
FT                   /db_xref="taxon:10090"
FT   CDS             264..1772
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="activin A receptor, type II-like 1 (MGD|MGI:1338946
FT                   GB|BC015083, evidence: BLASTN, 100%, match=1677)"
FT                   /note="putative"
FT                   /db_xref="GOA:Q61288"
FT                   /db_xref="InterPro:IPR000333"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR001245"
FT                   /db_xref="InterPro:IPR003605"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="MGI:MGI:1338946"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q61288"
FT                   /protein_id="BAE36089.1"
FT                   /translation="MTLGSFRRGLLMLSVAFGLTRGDLAKPSKLVNCTCESPHCKRPFC
FT                   QGSWCTVVLVREQGRHPQVYRGCGSLNQELCLGRPTEFLNHHCCYRSFCNHNVSLMLEA
FT                   TQTPSEEPEVDAHLPLILGPVLALPVLVALGALGLWRVRRRQEKQRDLHSDLGESSLIL
FT                   KASEQADSMLGDFLDSDCTTGSGSGLPFLVQRTVARQVALVECVGKGRYGEVWRGSWHG
FT                   ESVAVKIFSSRDEQSWFRETEIYNTVLLRHDNILGFIASDMTSRNSSTQLWLITHYHEH
FT                   GSLYDFLQRQTLEPQLALRLAVSAACGLAHLHVEIFGTQGKPAIAHRDLKSRNVLVKSN
FT                   LQCCIADLGLAVMHSQSSDYLDIGNNPRVGTKRYMAPEVLDEHIRTDCFESYKWTDIWA
FT                   FGLVLWEIARRTIINGIVEDYRPPFYDMVPNDPSFEDMKKVVCVDQQTPTIPNRLAADP
FT                   VLSGLAQMMRECWYPNPSARLTALRIKKTLQKLSHNPEKPKVIH"
XX
SQ   Sequence 1934 BP; 397 A; 553 C; 581 G; 403 T; 0 other;
     gttttcttag cgctgttcct taggagtgag cacagcccct tcccagtccc cggaggccgc        60
     cgcgccagcc gcgcagatcg agacctttcc cggccccaca ggccggctct ggacgtgaga       120
     ccccggccgc ctccggcaag gagaggcggg ggtcgagtcg ccctgtccaa agagctggcc       180
     tcagattttc agtccacctg attcagcttt agtctctttc ctgccctgcc tcaggaggct       240
     tctgagtgct gggatacagg accatgacct tggggagctt cagaaggggc cttttgatgc       300
     tgtcggtggc ctttggccta accaggggag acttggcgaa gccttccaag ctggtgaact       360
     gcacttgtga gagcccacac tgcaagagac cattctgcca ggggtcatgg tgcacagtgg       420
     tgctggttcg ggagcagggc aggcaccccc aggtctatcg gggctgcggg agcctgaacc       480
     aggagctctg cttgggacgt cccacagagt ttctgaacca tcactgctgc tatagatcct       540
     tctgcaacca caacgtgtct ctgatgctgg aggccaccca aactccttcg gaggagccag       600
     aagttgatgc ccatctgcct ctgatcctgg gtcctgtgct ggccttgccg gtcctggtgg       660
     ccctgggtgc tctaggcttg tggcgtgtcc ggcggaggca ggagaagcag cgggatttgc       720
     acagtgacct gggcgagtcc agtctcatcc tgaaggcatc tgaacaggca gacagcatgt       780
     tgggggactt cctggacagc gactgtacta cgggcagcgg ctcggggctc cccttcttgg       840
     tgcagaggac ggtagctcgg caggttgcgc tggtagagtg tgtgggaaag ggccgatatg       900
     gtgaggtgtg gcgcggttcg tggcatggcg agagtgtggc ggtcaagatt ttctcctcac       960
     gagatgagca gtcctggttc cgggagacgg agatctacaa cacagttctg cttagacacg      1020
     acaacatcct aggcttcatc gcctccgaca tgacttcgcg gaactcgagc acgcagctgt      1080
     ggctcatcac ccactaccat gaacacggct ccctctatga ctttctgcag aggcagacgc      1140
     tggagcccca gttggccctg aggctagctg tgtccgcggc ctgcggcctg gcgcacctac      1200
     atgtggagat ctttggcact caaggcaaac cagccattgc ccatcgtgac ctcaagagtc      1260
     gcaatgtgct ggtcaagagt aacttgcagt gttgcattgc agacctggga ctggctgtga      1320
     tgcactcaca aagcagcgat tacctggata tcggcaacaa cccccgagtg ggtaccaaaa      1380
     gatacatggc acccgaggtg ctggatgagc acatccgcac agactgcttt gagtcgtaca      1440
     agtggacaga catctgggcc tttggcctag tgctatggga gatcgcccgg cggaccatca      1500
     tcaatggcat tgtggaggat tacaggccac ctttctatga catggtaccc aatgacccca      1560
     gttttgagga catgaaaaag gtggtgtgcg ttgaccagca gacacccacc atccctaacc      1620
     ggctggctgc agatccggtc ctctccgggc tggcccagat gatgagagag tgctggtacc      1680
     ccaacccctc tgctcgcctc accgcactgc gcataaagaa gacattgcag aagctcagtc      1740
     acaatccaga gaagcccaaa gtgattcact agcccagggc caccaggctt cctctgccta      1800
     aagtgtgtgc tggggcagaa gacatagcct gtctgggtag agggagtgaa gagagtgtgc      1860
     acgctgccct gtgtgtgcct gctcagcttg gctcccagcc catccagcca aaaatacagc      1920
     tgagctgaaa ttcg                                                        1934
//