Dbfetch

ID   AK160743; SV 1; linear; mRNA; HTC; MUS; 2775 BP.
XX
AC   AK160743;
XX
DT   09-SEP-2005 (Rel. 85, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 10)
XX
DE   Mus musculus 13 days embryo head cDNA, RIKEN full-length enriched library,
DE   clone:3110004I03 product:protein phosphatase 1, catalytic subunit, beta
DE   isoform, full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2775
RA   Arakawa T., Carninci P., Fukuda S., Hashizume W., Hayashida K., Hori F.,
RA   Iida J., Imamura K., Imotani K., Itoh M., Kanagawa S., Kawai J., Kojima M.,
RA   Konno H., Murata M., Nakamura M., Ninomiya N., Nishiyori H., Nomura K.,
RA   Ohno M., Sakazume N., Sano H., Sasaki D., Shibata K., Shiraki T.,
RA   Tagami M., Tagami Y., Waki K., Watahiki A., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (14-APR-2004) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science, e1252229 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science, e1252229 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; bbe012c906f08940ffede17b1e902da2.
DR   Ensembl-Gn; ENSMUSG00000014956; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0029435; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0029401; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0029351; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0029412; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0029133; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0029865; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0028543; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0029101; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0029250; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0029208; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0029335; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0029237; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0029899; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0028268; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0028624; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000015100; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000201360; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0070976; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0071059; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0070960; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0070984; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0070630; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0071464; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0071166; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0070570; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0070707; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0070617; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0070780; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0070642; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0071660; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0070636; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0069787; mus_musculus_wsbeij.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=3110004I03
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2775
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /dev_stage="13 days embryo"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="3110004I03"
FT                   /tissue_type="head"
FT                   /db_xref="taxon:10090"
FT   CDS             96..1079
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="protein phosphatase 1, catalytic subunit, beta
FT                   isoform (MGD|MGI:104871 GB|NM_172707, evidence: BLASTN,
FT                   99%, match=2774)"
FT                   /note="putative"
FT                   /db_xref="GOA:P62141"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR006186"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR031675"
FT                   /db_xref="MGI:MGI:104871"
FT                   /db_xref="UniProtKB/Swiss-Prot:P62141"
FT                   /protein_id="BAE35984.1"
FT                   /translation="MADGELNVDSLITRLLEVRGCRPGKIVQMTEAEVRGLCIKSREIF
FT                   LSQPILLELEAPLKICGDIHGQYTDLLRLFEYGGFPPEANYLFLGDYVDRGKQSLETIC
FT                   LLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRFNIKLWKTFTDCFNCLPIAAI
FT                   VDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDTGLLCDLLWSDPDKDVQGWGENDRGV
FT                   SFTFGADVVSKFLNRHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGGM
FT                   MSVDETLMCSFQILKPSEKKAKYQYGGLNSGRPVTPPRTANPPKKR"
XX
SQ   Sequence 2775 BP; 794 A; 468 C; 568 G; 945 T; 0 other;
     gaacgccgcg tgactcgtag gtgagaacgc cgagccgccg ccgccgccga gaagccctgt        60
     taacgcttta gggaggagag tctggtgccg acaagatggc ggacggggag ctgaacgtgg       120
     acagcctcat cacccgcctg ctggaggtac gaggatgtcg tccaggaaag attgtacaaa       180
     tgactgaagc agaagtccga gggttgtgta tcaagtctcg tgaaatcttt ctcagccagc       240
     ctattctttt ggaattggaa gcaccactga agatttgtgg agacatacat ggacaatata       300
     cagacttact aagattattt gaatatggag gttttccacc agaagccaac tatcttttct       360
     taggagatta tgtggacaga ggaaagcagt ctttggaaac catctgtttg ctattggctt       420
     acaaaatcaa atacccggag aacttctttc ttctaagagg aaaccatgag tgtgctagca       480
     tcaatcgcat ttatggattc tacgatgagt gtaaacgaag atttaatatt aaattgtgga       540
     agacattcac tgattgtttt aactgtctgc ctatagctgc tattgttgat gagaaaatct       600
     tctgttgtca tggaggactg tcaccagacc tacaatctat ggaacagatt cggagaatta       660
     tgagacccac tgacgtacct gatacaggtt tgctttgtga cttactgtgg tccgacccag       720
     ataaggatgt gcaaggctgg ggagaaaatg accgtggtgt ttcttttact tttggagctg       780
     atgtagtcag taaatttctg aatcgtcatg atttagactt gatttgtcga gctcatcagg       840
     tggtggaaga cggatatgaa ttttttgcta aacgacagtt ggtaacctta ttttctgccc       900
     caaattactg tggcgagttt gacaatgctg gtggtatgat gagtgtggat gagactttga       960
     tgtgttcatt ccagatattg aaaccatctg aaaagaaagc taagtaccag tatggtgggc      1020
     tgaattctgg acgtcctgtc actccgcctc gaacagctaa tccaccgaag aaaaggtgaa      1080
     gacaggaatt ctagaaagag aaaccatcag atttgttaag gacatacttc ataatatata      1140
     agtgtgcact gtaaaaccat ccagccattc gacacccttt atgatgtcac acctttaact      1200
     taaggagacg gtaaaggatc ttaaattttt ttctaataga aagatgtgct acactgtatt      1260
     gtaataagta tactctgtta taatattcaa caaaattaaa tccaaattca aaagtatcca      1320
     ttaaagttct atcttctcat atcacagttt ttaaagttga aaagcatccc agttaaacta      1380
     gccctgttag tgacccagat gaaagcatga agatccatct gtgtaatgtg gttttagtgg      1440
     tgcttggttg tttcattatt ttgagcttgt tttgttttgt ttgtttttgc tagaataatg      1500
     gcatctactt ttcctatttt tccctaaaca tttttaaaag tgaaaatggg aagagcttta      1560
     aagacattca ccaactattc ttttccttta cttatctact taagtaactg ttggatctta      1620
     ctaagaaaac ttacccctca ttacagtaaa aaggaacttt agaggtcgat aggttttaaa      1680
     aatatacaaa ctatctgatc cattgatttt aatcaaacag tttgactggg caaactttgc      1740
     agctgataat gagtatttcg ctttttacaa aattgccact gatttggatt tgtgcactct      1800
     aatctttaat ttattgatgc tctattgtgc agtagcattt catttaagat aaggctcata      1860
     tagtaatatc caaaactagt tggtaatgtg attatgtggt actttggctt tgggttctaa      1920
     ttcgcacgaa acaccttttg gcatgcttaa ctttctggta ttaccctcac ctgcattggt      1980
     tttgtttttt ggggtttttg ttgtttgttt gtttttagat tcacagaaca tgagaatcct      2040
     ttttgacaag ccttggatag ctggctctct tctttccctc tctctatgtg aaggatgtat      2100
     ttaaatgaac gctggtcagt gggacatttg tcagctctga atattgggtg cttcactaat      2160
     aattgccatg tgaatgttgt tttgactgta aggctatgtc actaaagatt tttactctgc      2220
     gttttcataa tcaaaggtca tgatgtgtat agacatgctt tgtagtgaag tatagtagca      2280
     ataatttctg tatgtgatca agagtttatt gcattatttc tttccctgtt ctcttttttt      2340
     tttttttaag ggttagcatt aacaaatgtc aaggagtagc aaagtcaaca aagattttag      2400
     aaggaggagg aactaagagc atacacagac ttatgattct ttggatgtga cacttattgg      2460
     atgtgattct aaagtctttt attgaacatt gtcaaattcg tacgcttcat aggatggaca      2520
     taatgtttat ataatgccct tcttatgtgt taccatagat gtgtgaaacc ttatagcgtc      2580
     cttgaaagtg ttaaattgag aactctgtta acattttatg gattgacaca ttatattact      2640
     gcaagtaaca tttgattttc agcacagtgc aaaagttctt taaaatgcat atgtcttttt      2700
     ttttctaatt ccattttgtt taaagcacat tttaaatgta gttttctcat ttagtaaaag      2760
     ttgtctaatt gatac                                                       2775
//