spacer

EBI Dbfetch

ID   AK160577; SV 1; linear; mRNA; HTC; MUS; 2141 BP.
XX
AC   AK160577;
XX
DT   09-SEP-2005 (Rel. 85, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 10)
XX
DE   Mus musculus ES cells cDNA, RIKEN full-length enriched library,
DE   clone:2410158E12 product:gamma-aminobutyric acid (GABA-A) receptor, pi,
DE   full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2141
RA   Arakawa T., Carninci P., Fukuda S., Hashizume W., Hayashida K., Hori F.,
RA   Iida J., Imamura K., Imotani K., Itoh M., Kanagawa S., Kawai J., Kojima M.,
RA   Konno H., Murata M., Nakamura M., Ninomiya N., Nishiyori H., Nomura K.,
RA   Ohno M., Sakazume N., Sano H., Sasaki D., Shibata K., Shiraki T.,
RA   Tagami M., Tagami Y., Waki K., Watahiki A., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (14-APR-2004) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; f3637d4a3d0c8c3770a802783e8ed7de.
DR   Ensembl-Gn; ENSMUSG00000020159; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000020366; mus_musculus.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=2410158E12
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2141
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="2410158E12"
FT                   /cell_type="ES cells"
FT                   /db_xref="taxon:10090"
FT   CDS             203..1525
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="gamma-aminobutyric acid (GABA-A) receptor, pi
FT                   (MGD|MGI:2387597 GB|NM_146017, evidence: BLASTN, 99%,
FT                   match=2137)"
FT                   /note="putative"
FT                   /db_xref="GOA:Q8QZW7"
FT                   /db_xref="InterPro:IPR006028"
FT                   /db_xref="InterPro:IPR006029"
FT                   /db_xref="InterPro:IPR006201"
FT                   /db_xref="InterPro:IPR006202"
FT                   /db_xref="InterPro:IPR008100"
FT                   /db_xref="InterPro:IPR018000"
FT                   /db_xref="MGI:MGI:2387597"
FT                   /protein_id="BAE35885.1"
FT                   /translation="MSYSLYLAFLCLSLLTQRTCIQGNQVNVEVSRSDKLSLPGFENLT
FT                   AGYNKFLRPNFGGDPVRIALTLDIASISSISESNMDYTATIYLRQRWTDPRLVFEGNKS
FT                   FTLDARLVEFLWVPDTYIVESKKSFLHEVTVGNRLIRLFSNGTVLYALRITTTVTCNMD
FT                   LSKYPMDTQTCKLQLESWGYDGNDVEFSWLRGNDSVRGLENLRLAQYTIQQYFTLVTVS
FT                   QQETGNYTRLVLQFELRRNVLYFILETYVPSTFLVVLSWVSFWISLDSVPARTCIGVTT
FT                   VLSMTTLMIGSRTSLPNTNCFIKAIDVYLGICFSFVFGALLEYAVAHYSSLQQMAVKDR
FT                   GPAKDSEEVNITNIINSSISSFKRKISFASIEISGDNVNYSDLTMKASDKFKFVFREKI
FT                   SRIIDYFTIQNPSNVDRYSKLLFPLIFMLANVFYWAYYMYF"
FT   polyA_signal    2119..2124
FT                   /note="putative"
FT   polyA_site      2141
FT                   /note="putative"
XX
SQ   Sequence 2141 BP; 594 A; 513 C; 450 G; 584 T; 0 other;
     gagagagaga gcgcgccact ccatcggaga ctgggtgcat acttaacacc caaagagtca        60
     ggactgagat gaaaaggacc ctggagaccc aaaagagtat gctctgtgtg agagtcctgc       120
     ctgagatctg gaaacacctg ctgtaacagc tgcctggtga ttcctccttc aacctttttg       180
     tgtgtgaatc agctccttca acatgagcta cagcctctat ttggccttcc tgtgtctgag       240
     tctcctcact cagaggacgt gcatccaggg gaaccaggtc aatgtggagg tcagcagaag       300
     tgacaagctt tccttacctg gctttgagaa cctcactgca ggatataaca aattcctcag       360
     gcccaatttc ggtggtgacc cagttcggat agcactgact ctggacatcg ccagcatctc       420
     tagcatctca gagagtaaca tggactacac agccactata tacctccggc agcgttggac       480
     agacccacgg ctagtgttcg aaggcaacaa gagctttact ctagatgccc gccttgtgga       540
     gttcctctgg gtgccagaca cttacattgt agagtccaag aagtccttcc tccatgaagt       600
     cacagtggga aacaggctca tccgcctctt ctccaacggc acagtcctgt acgcacttag       660
     aatcacaaca acagttacat gtaacatgga tctgtctaaa taccccatgg acacacagac       720
     ctgcaagctg cagctagaaa gttggggata cgatggcaat gatgtggagt tctcctggct       780
     gagagggaat gactcggtgc gtggacttga aaacctgcgc cttgctcagt acacaatcca       840
     acagtatttc accctggtca ccgtatccca gcaggagaca ggaaactata cgagattggt       900
     tttgcaattt gagcttcgga ggaacgtcct gtatttcatt ctggaaacct atgtcccttc       960
     caccttcctg gtggtgttat cctgggtctc cttttggatc tccctcgatt cagttcctgc      1020
     gagaacctgc attggagtga caacggtgtt atccatgaca acgctgatga tcggctcccg      1080
     cacatcccta cccaacacca actgcttcat aaaggccatc gatgtgtacc taggcatctg      1140
     cttcagcttc gtgtttgggg ccttactgga gtatgcagtt gctcactaca gctccttaca      1200
     gcagatggca gtcaaagata gggggccagc gaaggactcg gaagaagtca atatcaccaa      1260
     catcatcaac agctccatct ccagctttaa acggaagatt agctttgcca gcattgaaat      1320
     ctctggtgac aatgtcaact atagtgactt gacaatgaaa gccagcgaca agtttaagtt      1380
     tgtcttccga gagaagatca gcagaatcat tgattatttc acaattcaaa accccagcaa      1440
     tgtggatcga tactccaaac tactatttcc tttgattttt atgttggcca atgtatttta      1500
     ctgggcatac tacatgtatt tttgagacgc cattgaactc ttgcatcaca taatgaggtt      1560
     aagggtattc tagaacatgt gtgtgcactt cagcttagaa agctacaaat gggctaatgt      1620
     aacaattatt ctaagttgtg tagaagccct agtgtgacca gattctataa tagagtcatt      1680
     ataaggcaac ccttttcttc ttcaattttg gacagaacac cccctccaca cacatacaca      1740
     gaacccaaga ctgcgaacct actcagggct atttgctctc tggatccctg gtctgcattc      1800
     actccataaa aatgtgggaa gatgattaca tatattaagg ggtttatttt ctaaagaatt      1860
     catagtgcca ctgattacat ctctgtggcc cttataatat gctctcttgc ctatttaaac      1920
     accagtgttt tctaattttt gtttttcctt gaaatatgaa atgtgggttt gcgtcaattc      1980
     attggtggtt accttgcctc atcaacctaa taccagatgg gttcttagtg ttatttaata      2040
     ccacagaaga attgtcccca aattctaata catcctatta ttcacaaatc agatgtaaat      2100
     gaataaaatt agtggatcaa taaactaaaa gaaaaaaaca t                          2141
//


spacer
spacer