spacer

EBI Dbfetch

ID   AK160570; SV 1; linear; mRNA; HTC; MUS; 1290 BP.
XX
AC   AK160570;
XX
DT   09-SEP-2005 (Rel. 85, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 10)
XX
DE   Mus musculus ES cells cDNA, RIKEN full-length enriched library,
DE   clone:2410136C19 product:neural precursor cell expressed, developmentally
DE   down-regulted gene 4, full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1290
RA   Arakawa T., Carninci P., Fukuda S., Hashizume W., Hayashida K., Hori F.,
RA   Iida J., Imamura K., Imotani K., Itoh M., Kanagawa S., Kawai J., Kojima M.,
RA   Konno H., Murata M., Nakamura M., Ninomiya N., Nishiyori H., Nomura K.,
RA   Ohno M., Sakazume N., Sano H., Sasaki D., Shibata K., Shiraki T.,
RA   Tagami M., Tagami Y., Waki K., Watahiki A., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (14-APR-2004) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; 22b208d30e88dc050cb302f7ab853719.
DR   Ensembl-Gn; ENSMUSG00000032216; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000034740; mus_musculus.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=2410136C19
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1290
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="2410136C19"
FT                   /cell_type="ES cells"
FT                   /db_xref="taxon:10090"
FT   CDS             76..1272
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="neural precursor cell expressed, developmentally
FT                   down-regulted gene 4 (MGD|MGI:97297 GB|D85414, evidence:
FT                   BLASTN, 99%, match=1267)"
FT                   /note="putative"
FT                   /db_xref="GOA:Q3TUU1"
FT                   /db_xref="InterPro:IPR000008"
FT                   /db_xref="InterPro:IPR001202"
FT                   /db_xref="MGI:MGI:97297"
FT                   /db_xref="UniProtKB/TrEMBL:Q3TUU1"
FT                   /protein_id="BAE35880.1"
FT                   /translation="MSSDMAADESEAPVLSEDEVWEFCLDKTEDGGGSPGSDVTDTCEP
FT                   PCGCWELNPNSLEEEHVLFTADPYLELHNDDTRVVRVKVIAGIGLAKKDILGASDPYVR
FT                   VTLYDPMSGILTSVQTKTIKKSLNPKWNEEILFRVLPQRHRILFEVFDENRLTRDDFLG
FT                   QVDVPLYPLPTENPRMERPYTFKDFVLHPRSHKSRVKGYLRLKMTYLPKNGSEDENADQ
FT                   AEELEPGWVVLDQPDAATHLPHPPEPSPLPPGWEERQDVLGRTYYVNHESRRTQWKRPS
FT                   PDDDLTDEDNDDMQLQAQRAFTTRRQISEDVDGPDNRESPENWEIVREDENTEYSGQAV
FT                   QSPPSGHIDVQTHLAEEFNTRLAVCGNPATSQPVTSSNHSSRGGSLQTCIFEEQPTLP"
XX
SQ   Sequence 1290 BP; 357 A; 308 C; 330 G; 295 T; 0 other;
     gctcttcctc tctccttctc tctcggtctc tcgctctctc tcgccgctgc agcctagtag        60
     gggcgcttct ccagcatgag ctcggacatg gcagccgacg agtcggaggc cccagtactc       120
     tcggaggacg aggtatggga gttttgcctg gataagacag aagatggtgg cggatccccc       180
     ggaagtgatg ttacagatac ttgtgagcct ccatgtggat gctgggagtt gaatccgaat       240
     tccctggaag aggagcacgt gctgttcact gctgatccgt acctggagct ccacaacgat       300
     gacacacgag ttgtgagagt gaaggttata gctggcatag gcctggccaa gaaagacatc       360
     ttgggagcca gtgatcctta cgtaagagtg acattgtatg acccgatgag tggaatcctt       420
     accagcgtgc agacaaaaac tatcaaaaag tctttgaatc caaaatggaa tgaagaaata       480
     ctgttcaggg tccttccaca gcgacaccgc attcttttcg aagtgtttga tgaaaatcgt       540
     ttgacaagag atgatttcct aggtcaagtg gatgtccctc tctatccttt accgactgaa       600
     aacccaagaa tggagagacc atatacattt aaggattttg ttcttcatcc aagaagtcac       660
     aaatcaagag ttaaaggtta tctgagatta aaaatgactt atttacctaa aaatggctca       720
     gaagatgaaa atgcagacca ggctgaggag ttagagcctg gctgggttgt tttggaccaa       780
     ccagatgctg ccactcattt gccgcatcca ccagaaccct ctcccctacc tccaggatgg       840
     gaagagaggc aggatgtcct tggaaggacc tactacgtaa accatgaatc tagaagaaca       900
     cagtggaaaa ggccaagccc tgacgatgac ctcacggatg aagacaatga tgatatgcag       960
     ctgcaagcgc agcgagcatt caccaccagg cggcagatat cggaggatgt ggatggccct      1020
     gacaaccggg agtcccctga gaattgggaa atcgtacgag aagatgaaaa caccgagtat      1080
     agtggtcagg ctgtccagtc acctccatcg ggtcacattg atgtgcagac tcaccttgca      1140
     gaagagttta ataccagact tgctgtgtgt ggaaatccag ccaccagcca gccggttacc      1200
     agctcaaatc attccagcag aggaggcagc ttgcagacct gtatctttga ggaacagcct      1260
     acacttccat aaagggctgc atgcttattg                                       1290
//


spacer
spacer