Dbfetch

ID   AK160534; SV 1; linear; mRNA; HTC; MUS; 1485 BP.
XX
AC   AK160534;
XX
DT   09-SEP-2005 (Rel. 85, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 10)
XX
DE   Mus musculus ES cells cDNA, RIKEN full-length enriched library,
DE   clone:2410006M21 product:Adiponectin receptor protein 2, full insert
DE   sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1485
RA   Arakawa T., Carninci P., Fukuda S., Hashizume W., Hayashida K., Hori F.,
RA   Iida J., Imamura K., Imotani K., Itoh M., Kanagawa S., Kawai J., Kojima M.,
RA   Konno H., Murata M., Nakamura M., Ninomiya N., Nishiyori H., Nomura K.,
RA   Ohno M., Sakazume N., Sano H., Sasaki D., Shibata K., Shiraki T.,
RA   Tagami M., Tagami Y., Waki K., Watahiki A., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (14-APR-2004) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science, e1252229 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science, e1252229 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; 07dd18ea9d2c8f6811f0ec49e741ee47.
DR   Ensembl-Gn; ENSMUSG00000030168; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000032272; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000169744; mus_musculus.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=2410006M21
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1485
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="2410006M21"
FT                   /cell_type="ES cells"
FT                   /db_xref="taxon:10090"
FT   CDS             170..1330
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="Adiponectin receptor protein 2 (UniProt|Q8BQS5,
FT                   evidence: FASTY, 100%ID, 100%length, match=1158)"
FT                   /note="putative"
FT                   /db_xref="GOA:Q53YY3"
FT                   /db_xref="InterPro:IPR004254"
FT                   /db_xref="MGI:MGI:93830"
FT                   /db_xref="UniProtKB/TrEMBL:Q53YY3"
FT                   /protein_id="BAE35851.1"
FT                   /translation="MNEPAKHRLGCTRTPEPDIRLRKGHQLDDTRGSNNDNYQGDLEPS
FT                   LETPVCSSYYENSPEEPECHDDNSQEDEGFMGMSPLLQAHHAMERMEEFVCKVWEGRWR
FT                   VIPHDVLPDWLKDNDFLLHGHRPPMPSFRACFKSIFRIHTETGNIWTHLLGCVFFLCLG
FT                   IFYMFRPNISFVAPLQEKVVFGLFFLGAILCLSFSWLFHTVYCHSEGVSRLFSKLDYSG
FT                   IALLIMGSFVPWLYYSFYCNPQPCFIYLIVICVLGIAAIIVSQWDMFATPQYRGVRAGV
FT                   FVGLGLSGIIPTLHYVISEGFLKAATIGQIGWLMLMASLYITGAALYAARIPERFFPGK
FT                   CDIWFHSHQLFHIFVVAGAFVHFHGVSNLQEFRFMIGGGCTEEDAL"
XX
SQ   Sequence 1485 BP; 335 A; 378 C; 364 G; 408 T; 0 other;
     gaagtctttc cacacaacac aagaatccgt ggagctcagc agtaccctca gactctggtc        60
     tacaactctg acaggatttg gggtcaactt accatccctt aaaaatccat tctcccaaga       120
     agaagggaca gaaagaaaga ccactttgta agaaaggctt tggtatccca tgaacgagcc       180
     agccaaacac cgattggggt gcaccaggac tccagagcca gatatacggc tcagaaaagg       240
     gcaccaactt gatgatacaa ggggaagtaa taatgacaac taccaaggag atttggagcc       300
     cagcttagag acacctgttt gttcttccta ttatgaaaat agcccggagg agcccgagtg       360
     tcatgatgac aattcccagg aagatgaagg gtttatgggc atgtccccgc tcctacaggc       420
     ccatcatgct atggaacgaa tggaagagtt tgtttgtaag gtgtgggaag gccgatggcg       480
     agtgatccct cacgatgtgc taccggattg gcttaaggat aatgacttcc ttctccatgg       540
     acaccggcct cctatgcctt cctttcgggc ctgttttaag agcattttta gaatacacac       600
     agagacgggc aacatttgga cacatctcct aggttgtgta ttcttcctgt gcctggggat       660
     cttttatatg tttcgcccaa atatatcttt tgtggcccct ctgcaagaga aagtggtctt       720
     tggcttgttc ttcttgggag ccattctctg cctttccttt tcatggctct tccacacggt       780
     gtactgccac tcagaagggg tctcccgact cttctctaaa ttggattact ctggtattgc       840
     tcttctgatc atgggaagtt ttgttccttg gctttattat tctttctact gtaacccaca       900
     accttgcttc atctacctga ttgtcatctg tgtgctgggc attgcagcca ttatcgtctc       960
     tcagtgggac atgtttgcca cccctcagta tcggggggtc agagcaggag tgttcgtggg      1020
     cttaggcctg agtggaatca tccctacctt gcattatgtc atctcagaag ggttcctgaa      1080
     ggctgccacc atagggcaga taggctggct aatgcttatg gctagcctct atatcaccgg      1140
     agctgccctc tatgcggccc gtatccctga gcgcttcttt cctggcaaat gtgacatctg      1200
     gtttcactct catcagctct tccacatctt tgtggttgct ggtgcctttg ttcacttcca      1260
     cggagtctca aacctgcagg aatttcgttt catgattggc gggggctgca ctgaagagga      1320
     tgcactgtga tactctccag gaaccaggga ctctgaccct gagccaggcc tgcaggtcct      1380
     gcaggccttc ttactggctg tcggtgccag tgccagagaa gccccaaaac ttggacagcc      1440
     tcatgggcct tgtgttggcc caagggctcc atggggtaca agact                      1485
//