Dbfetch

ID   AK160461; SV 1; linear; mRNA; HTC; MUS; 1267 BP.
XX
AC   AK160461;
XX
DT   09-SEP-2005 (Rel. 85, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 10)
XX
DE   Mus musculus 10 day old male pancreas cDNA, RIKEN full-length enriched
DE   library, clone:1810058P07 product:Da2-24 homolog [Rattus norvegicus], full
DE   insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1267
RA   Arakawa T., Carninci P., Fukuda S., Hashizume W., Hayashida K., Hori F.,
RA   Iida J., Imamura K., Imotani K., Itoh M., Kanagawa S., Kawai J., Kojima M.,
RA   Konno H., Murata M., Nakamura M., Ninomiya N., Nishiyori H., Nomura K.,
RA   Ohno M., Sakazume N., Sano H., Sasaki D., Shibata K., Shiraki T.,
RA   Tagami M., Tagami Y., Waki K., Watahiki A., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (14-APR-2004) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science, e1252229 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science, e1252229 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; 60c56d6edfbac26a179a89453eaaf2ef.
DR   Ensembl-Gn; ENSMUSG00000021916; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0021115; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0021063; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0021040; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0021067; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0020850; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0021499; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0020375; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0020817; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0020939; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0020923; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0021008; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0020949; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0021532; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0020123; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0020430; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000022476; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000168584; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0038721; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0038683; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0038645; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0038687; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0038430; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0039141; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0038439; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0038350; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0038491; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0038462; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0038581; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0038447; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0039186; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0038053; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0037836; mus_musculus_wsbeij.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=1810058P07
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1267
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /sex="male"
FT                   /dev_stage="10 day old"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="1810058P07"
FT                   /tissue_type="pancreas"
FT                   /db_xref="taxon:10090"
FT   CDS             235..918
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="Da2-24 homolog [Rattus norvegicus] (UniProt|Q7TP03,
FT                   evidence: FASTY, 85%ID, 58.3%length, match=698)"
FT                   /note="putative"
FT                   /db_xref="GOA:Q6NSU3"
FT                   /db_xref="InterPro:IPR002495"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="MGI:MGI:1923735"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6NSU3"
FT                   /protein_id="BAE35802.1"
FT                   /translation="MSFRKVNIIIWVLAVVLFLLVLHHNFLSLSSLLKNDISDSGIVGL
FT                   QPIDFVASAHQHPVSERQEEIPVVIAASEDRLGGTIAAINSVHQNTRSNVMFYIVTFNS
FT                   TADHLRSWLNSGSLKSIRYKIVNFDTKLLEGKVKQDPDQGESMKPLTFARFYLPILVPS
FT                   AKKAIYMDDDVIVQGDILALYNTPLKPGHAAAFSEDCDSASTKVIIRGAGNQVMTYCRS
FT                   HSGKA"
FT   regulatory      1249..1254
FT                   /note="putative"
FT                   /regulatory_class="polyA_signal_sequence"
FT   polyA_site      1267
FT                   /note="putative"
XX
SQ   Sequence 1267 BP; 353 A; 299 C; 291 G; 324 T; 0 other;
     gaggtaaggg cgactgcgcc cagcctcgga aggcgacgat tcgtctgacg cggctctaac        60
     ctgacctgtc agtgcgtggc gggatccccg gagcgcctca ccacgtcccc atcactccta       120
     agcaccaagg aacccggaaa gacatgccag gaaagacagc atgatgagac ttattctgaa       180
     atccggtcct tttcatggtt aatttctaat gtttgtgtaa gacagaagaa aaggatgtca       240
     ttccgtaaag tgaacatcat catctgggtc ctggctgttg ttctcttctt actggttttg       300
     caccataact tcctcagctt gagcagtttg ttaaagaatg acatttcaga ttcgggaatt       360
     gtggggcttc agcccataga ctttgtcgcc agtgctcatc agcatccagt gagtgagagg       420
     caagaggaga ttcccgtggt tattgctgcc tctgaagaca ggctgggtgg gaccattgca       480
     gccataaaca gcgttcatca aaacacgcgc tccaatgtga tgttttacat tgttacattc       540
     aacagcacag cagaccatct ccggtcctgg cttaacagtg gttccttgaa aagcatcagg       600
     tacaaaattg taaattttga cactaaactt ttggaaggga aagtaaagca ggatcctgac       660
     cagggggagt ccatgaaacc attaaccttt gcaaggttct acttgccaat tctggttccc       720
     agtgcaaaga aagccatata catggatgat gatgtcattg tacaaggtga catacttgcc       780
     ttgtacaata caccactgaa gccaggacat gctgctgcgt tttcagaaga ttgtgactca       840
     gcctccacta aagtcatcat ccggggagca gggaaccagg tgatgactta ctgcagatct       900
     cactccggga aagcttaatg agaaatgtta aagccagggc tccatcgtac attaactagt       960
     cattgctctc cagacctcac acctacctgt ttatagattc tgtggattca tggactttac      1020
     aaccaaattg tccttgaatg ctaagacaaa ctctagatct caactgttaa ttctgtagga      1080
     tctgtcactt ttgctaataa tttaggaagc caagctcaaa tattgccctg tgacacacct      1140
     ttaatcctag cacttgagag gcagaggcag gcagatctga gttggaggcc agcctggtct      1200
     acaaagttcc tggacagctg gggcttcaca gagaaaccct gtctcagaaa taaaaaaaag      1260
     tccaact                                                                1267
//