Dbfetch

ID   AK160442; SV 1; linear; mRNA; HTC; MUS; 727 BP.
XX
AC   AK160442;
XX
DT   09-SEP-2005 (Rel. 85, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 10)
XX
DE   Mus musculus 10 day old male pancreas cDNA, RIKEN full-length enriched
DE   library, clone:1810010M12 product:nucleobindin 2, full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-727
RA   Arakawa T., Carninci P., Fukuda S., Hashizume W., Hayashida K., Hori F.,
RA   Iida J., Imamura K., Imotani K., Itoh M., Kanagawa S., Kawai J., Kojima M.,
RA   Konno H., Murata M., Nakamura M., Ninomiya N., Nishiyori H., Nomura K.,
RA   Ohno M., Sakazume N., Sano H., Sasaki D., Shibata K., Shiraki T.,
RA   Tagami M., Tagami Y., Waki K., Watahiki A., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (14-APR-2004) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science, e1252229 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science, e1252229 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; 2b3be9b5321d2063d3e051f49599bdee.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=1810010M12
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..727
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /sex="male"
FT                   /dev_stage="10 day old"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="1810010M12"
FT                   /tissue_type="pancreas"
FT                   /db_xref="taxon:10090"
FT   CDS             136..>727
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="nucleobindin 2 (MGD|MGI:1858179 GB|BC010459,
FT                   evidence: BLASTN, 99%, match=726)"
FT                   /note="putative"
FT                   /db_xref="GOA:Q3TV28"
FT                   /db_xref="InterPro:IPR028813"
FT                   /db_xref="MGI:MGI:1858179"
FT                   /db_xref="UniProtKB/TrEMBL:Q3TV28"
FT                   /protein_id="BAE35792.1"
FT                   /translation="MRWRIIQVQYCFLLVPCMLTALEAVPIDVDKTKVHNTEPVENARI
FT                   EPPDTGLYYDEYLKQVIEVLETDPHFREKLQKADIEEIRSGRLSQELDLVSHKVRTRLD
FT                   ELKRQEVGRLRMLIKAKLDALQDTGMNHHLLLKQFEHLNHQNPNTFESRDLDMLIKAAT
FT                   ADLEQYDRTRHEEFKKYEMMKEHERREYLKTLSE"
XX
SQ   Sequence 727 BP; 246 A; 142 C; 181 G; 158 T; 0 other;
     accaggagcc aagtcctgat ctctacaaac ttaatattgt gtagattatt ttaccacctg        60
     agatctcagt ggcctcatct gtgcaagaaa gagaaaatta ataataaaaa agataaaacc       120
     ttggcctgtc tgaagatgag gtggaggatc atccaagtac agtactgttt tctcttggtt       180
     ccgtgcatgc tgaccgctct ggaagctgtt cctatcgatg tggacaagac caaagtacac       240
     aacactgagc cagtggaaaa tgcaaggata gagccaccag atactggact ttattatgat       300
     gaatacctca agcaagtgat tgaagtcttg gaaacagatc cacatttcag agaaaagctc       360
     cagaaagcag acatagagga gataaggagc gggaggctga gtcaagagct ggacttagta       420
     agtcacaaag tgaggacgag actggatgag ctgaagaggc aagaagtagg aagactgcgg       480
     atgctcatca aagctaagct ggatgccctt caagacactg gcatgaatca ccaccttctt       540
     ctgaagcagt ttgaacacct gaaccaccag aatcctaaca catttgaatc cagagatttg       600
     gatatgctaa tcaaagcagc taccgcggat ctggagcaat atgaccggac tcggcatgaa       660
     gagtttaaga agtacgagat gatgaaggaa cacgagcgga gagagtattt aaaaacgctg       720
     agtgagg                                                                 727
//