spacer

EBI Dbfetch

ID   AK160338; SV 1; linear; mRNA; HTC; MUS; 1551 BP.
XX
AC   AK160338;
XX
DT   06-SEP-2005 (Rel. 85, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 10)
XX
DE   Mus musculus 12 days embryo embryonic body between diaphragm region and
DE   neck cDNA, RIKEN full-length enriched library, clone:9430068N19
DE   product:nicastrin, full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1551
RA   Arakawa T., Carninci P., Fukuda S., Hashizume W., Hayashida K., Hori F.,
RA   Iida J., Imamura K., Imotani K., Itoh M., Kanagawa S., Kawai J., Kojima M.,
RA   Konno H., Murata M., Nakamura M., Ninomiya N., Nishiyori H., Nomura K.,
RA   Ohno M., Sakazume N., Sano H., Sasaki D., Shibata K., Shiraki T.,
RA   Tagami M., Tagami Y., Waki K., Watahiki A., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (30-MAR-2004) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; c615a512d35294c55cdb3ff439ee078a.
DR   Ensembl-Gn; ENSMUSG00000003458; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000003550; mus_musculus.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=9430068N19
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1551
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /dev_stage="12 days embryo"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="9430068N19"
FT                   /tissue_type="embryonic body between diaphragm region and
FT                   neck"
FT                   /db_xref="taxon:10090"
FT   CDS             <1..740
FT                   /codon_start=3
FT                   /transl_table=1
FT                   /note="nicastrin (MGD|MGI:1891700, evidence: Direct
FT                   assignment)"
FT                   /note="putative"
FT                   /note="start codon is not identified"
FT                   /db_xref="GOA:Q3TV74"
FT                   /db_xref="InterPro:IPR008710"
FT                   /db_xref="MGI:MGI:1891700"
FT                   /db_xref="UniProtKB/TrEMBL:Q3TV74"
FT                   /protein_id="BAE35745.1"
FT                   /translation="VTYPEWQSPEEDLNFVTDTAKALANVATVLARALYELAGGTNFSS
FT                   SIQADPQTVTRLLYGFLVRANNSWFQSILKHDLRSYLDDRPLQHYIAVSSPTNTTYVVQ
FT                   YALANLTGKATNLTREQCQDPSKVPNESKDLYEYSWVQGPWNSNRTERLPQCVRSTVRL
FT                   ARALSPAFELSQWSSTEYSTWAESRWKDIQARIFLIASKELEFITLIVGFSTLVFSLIV
FT                   TYCINAKADVLFVAPREPGAVSY"
FT   polyA_signal    1534..1539
FT                   /note="putative"
FT   polyA_site      1551
FT                   /note="putative"
XX
SQ   Sequence 1551 BP; 337 A; 463 C; 329 G; 421 T; 1 other;
     atgtgaccta tcctgagtgg cagagcccag aagaggacct caactttgtg acagacactg        60
     ccaaggcact ggcgaatgtg gccacagtgc tggcgcgtgc actgtatgag cttgcaggag       120
     gaaccaactt cagcagctcc atccaggctg atccccagac agttacacgt ctgctctatg       180
     ggttcctggt tagagctaac aactcatggt ttcagtcgat cttgaaacat gacctaaggt       240
     cctatttgga tgacagacct cttcaacact acatcgccgt ctccagccct accaacacga       300
     cttacgttgt gcagtacgcc ttggcaaacc tgactggcaa ggcgaccaac ctcacccgag       360
     agcagtgcca ggatccaagt aaagtcccaa atgagagcaa ggatttatat gaatactcgt       420
     gggtacaagg cccttggaat tccaacagga cagagaggct cccacagtgt gtgcgctcca       480
     cagtgcgact ggccagggcc ttgtcccctg cctttgaact gagtcagtgg agctccacag       540
     aatactctac gtgggcggag agccgctgga aagacatcca agctcggata ttcctaattg       600
     ccagcaaaga gcttgagttc atcacgctga tcgtgggctt cagcaccctt gtcttctccc       660
     tcatcgtcac ctactgcatc aatgccaaag ccgacgtcct tttcgttgct ccccgagagc       720
     caggagctgt gtcttactga agaggactct agctctccct gcctgctctg aactttactt       780
     cccagaccag gtgtccggct gggaacaaac cactaatttg tcactggact gtctctgggc       840
     ctgcttagac ggggattgac aacaccagaa atggnaactg ttaattggaa aagaatgaaa       900
     taaagtttgc ccccccccaa gccccccctt ttcccaattt gtttttctcc ctttctttta       960
     aatccccagg ggaattattg gttaggaaga ccttggctgg ttcccttaaa cttcccccca      1020
     ggtttaaccc ccaccccttc ctttttgccc cctttttttt cgggtattaa cccctttttt      1080
     tttttttttc cccccttttt tccccccccc aatttttccc ccttgggggc ccccccccct      1140
     ttgtttttgg ttggtgcccc ccgcttttga agcttccccc tgttccaccc cacccacccc      1200
     ccccccccca atattccacc ccaccctggg tccccccagg aaaggggggg gtgttgaaaa      1260
     ggtttggggc attcgcccat ttcaatatac cccttaaacc ccttaagggg aagaaaattg      1320
     gatttccccg tgggctgacc ccagtgtctc tttcccactc ccctttcccc gggtgcccag      1380
     gtcccatttt aggtgtgggc acgctgttaa gtgggtatcc cacctccagc ccacagtgct      1440
     cagttgtact ttttattatt aaactataat tatctatttt tgggggggtt ttttcctttt      1500
     tttttttttg taagtaaata aaaagcaagt ttcattaaaa ttatgccata c               1551
//


spacer
spacer