spacer

EBI Dbfetch

ID   AK160088; SV 1; linear; mRNA; HTC; MUS; 2550 BP.
XX
AC   AK160088;
XX
DT   06-SEP-2005 (Rel. 85, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 12)
XX
DE   Mus musculus osteoclast-like cell cDNA, RIKEN full-length enriched library,
DE   clone:I420048G16 product:UDP-GlcNAc:betaGal
DE   beta-1,3-N-acetylglucosaminyltransferase 1, full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2550
RA   Arakawa T., Carninci P., Fukuda S., Hashizume W., Hayashida K., Hori F.,
RA   Iida J., Imamura K., Imotani K., Itoh M., Kanagawa S., Kawai J., Kojima M.,
RA   Konno H., Murata M., Nakamura M., Ninomiya N., Nishiyori H., Nomura K.,
RA   Ohno M., Sakazume N., Sano H., Sasaki D., Shibata K., Shiraki T.,
RA   Tagami M., Tagami Y., Waki K., Watahiki A., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (30-MAR-2004) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   Ensembl-Gn; ENSMUSG00000051650; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000055549; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000062844; mus_musculus.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Tissues were provided by Takashi Ishikawa  ( Department of Surgery
CC   2 Yokohama City University 3-9 Fukuura,Kanazawa-ku,Yokohama
CC   236-0004 Japan ) whose assistance we gratefully acknowledge.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=I420048G16
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2550
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="I420048G16"
FT                   /cell_type="osteoclast-like cell"
FT                   /db_xref="taxon:10090"
FT   CDS             221..1414
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="UDP-GlcNAc:betaGal
FT                   beta-1,3-N-acetylglucosaminyltransferase 1 (MGD|MGI:1889505
FT                   GB|NM_016888, evidence: BLASTN, 99%, match=2526)"
FT                   /note="putative"
FT                   /db_xref="GOA:Q3TVJ9"
FT                   /db_xref="InterPro:IPR002659"
FT                   /db_xref="MGI:MGI:1889505"
FT                   /db_xref="UniProtKB/TrEMBL:Q3TVJ9"
FT                   /protein_id="BAE35619.1"
FT                   /translation="MSVGRRRVKLLGILMMANVFIYLIVEVSKNSSQDKNGKGGVIIPK
FT                   EKFWKPPSTPRAYWNREQEKLNRWYNPILNRVANQTGELATSPNTSHLSYCEPDSTVMT
FT                   AVTDFNNLPDRFKDFLLYLRCRNYSLLIDQPKKCAKKPFLLLAIKSLIPHFARRQAIRE
FT                   SWGRETNVGNQTVVRVFLLGKTPPEDNHPDLSDMLKFESDKHQDILMWNYRDTFFNLSL
FT                   KEVLFLRWVSTSCPDAEFVFKGDDDVFVNTHHILNYLNSLSKSKAKDLFIGDVIHNAGP
FT                   HRDKKLKYYIPEVFYTGVYPPYAGGGGFLYSGPLALRLYSATSRVHLYPIDDVYTGMCL
FT                   QKLGLVPEKHKGFRTFDIEEKNKKNICSYIDLMLVHSRKPQEMIDIWSQLQSPNLKC"
XX
SQ   Sequence 2550 BP; 675 A; 551 C; 617 G; 707 T; 0 other;
     ggagagtaag gctcagcggc cgccgcggca acaagtgctg gagctgaggc gagccggagc        60
     cgcccagacc ccgccgggcc gcccgtccgc gcattgcgca tggagcgaga gcggcggcgg       120
     tcgcggggct gagccgcaag agcggctggg acgtggatgc ggccgcggtc ttccgccccg       180
     ccccgccgag ctggaggtgt ccctagacaa ggtatgagag atgagtgtgg ggcgtcgaag       240
     agtcaagttg ctgggcatcc tgatgatggc aaatgtcttc atttatttga ttgtggaagt       300
     ctccaaaaac agtagccaag acaaaaatgg aaagggagga gtaataatcc cgaaagagaa       360
     gttctggaag ccacccagca ctccccgggc atactggaac agggaacagg agaagctgaa       420
     caggtggtac aatcccatct tgaacagggt ggccaatcag acaggggagc tagccacatc       480
     tccaaacaca agtcacctga gctattgtga accagactcg acggtcatga cagctgtgac       540
     agattttaat aatctgccgg acagatttaa agactttctc ttgtatttga gatgccggaa       600
     ttactcgctg cttatagatc aaccgaagaa atgtgcaaag aagcccttct tactattggc       660
     gataaagtcc ctcattccac attttgccag aaggcaagca attcgggagt cttggggccg       720
     agaaaccaac gtagggaacc agacagtagt gagggtcttc ctgttgggca agacaccccc       780
     agaggacaac caccctgacc tttcggacat gcttaagttt gagagtgaca agcaccagga       840
     catcctcatg tggaactata gagacacatt cttcaacctg tccctgaagg aagtgctgtt       900
     tcttaggtgg gtgagcactt cctgtccaga cgcagagttt gtcttcaagg gcgatgatga       960
     cgtgtttgtg aacacccatc acatccttaa ttacttgaat agcttatcca agagcaaagc      1020
     caaagacttg ttcataggtg acgtgatcca caatgctggg cctcaccggg ataagaaact      1080
     gaagtactac atcccagaag tcttctacac cggcgtctac ccaccgtatg ccgggggtgg      1140
     tggattcctg tactccggcc cccttgcctt gaggctgtac agtgcgacta gccgggtcca      1200
     tctctaccct attgatgatg tttatacggg aatgtgcctt cagaaactgg gccttgttcc      1260
     agagaagcac aaaggcttca ggacatttga tattgaagag aaaaataaga aaaatatttg      1320
     ttcctatata gacctaatgt tagtacatag cagaaaacct caagagatga ttgatatctg      1380
     gtctcagttg caaagtccta atttaaaatg ctgaaataga catgagctgc atttcacaga      1440
     aaggcctagc ctgactagtt cccatggtgt gctctcacaa taggtgagtt ctgtgtgagg      1500
     ctattagcct tcatgagcag gtagcccctg ggctcccaag ccctcagtcc ttcccttgcc      1560
     ttgtgaagag ggaaggctga agacagctca gcatggcagg gtgagtggtt atgacccttc      1620
     ctctggctgc cggtcctcag tttctaattt gttttctttc tcctccacaa ttatgtatgt      1680
     atgtgtgtat atatgtgtgt gtgtacatac atacatatat atatatgtat gacacaacct      1740
     ggtggctttg tgaaatggaa ttctatgtat tttcataaga ttttgaaagt tgtctagaaa      1800
     gtagactgat gtcaatctcc cgtcacccag cagtattgtc cttgttacta gaaaccgtta      1860
     cttcctttat gcaaggaaag ccacgcagtg cgtgtagttc atcttgtcag ggcttatggc      1920
     catgaggaca gaggggattt tctttttact tgtgtttggt ttcctgggtg gcatcatggt      1980
     agttaaccta tttttagtat ttgaagatca tgagtgtgat tccctaatgg ccaactggag      2040
     actgagtagc ccgacagcca tgggtctgtg agtgttcaga gactgggaag cattcgccac      2100
     ttctgagctt tggacgtgat tagtcagtta aaaccccaag attctattct tgccatatta      2160
     tcacgtattc cttagataaa attctgggta gtgacacttc cctgtctcag tgtagaagtg      2220
     cctgtgcttt tatttattgt tcagatcaaa caccaaaaca ttttcttaaa aaatattttg      2280
     tgtaatattt tatttgtata cagtgtttgt gaaatattta actagagcat gatattttat      2340
     tttttctcat ttttaattct ttgagaattt catacaatgt gttttgattg tattcacctc      2400
     cccatctcct cccagatcca gcatgatgtt ttaaatgtta agctgtaaca tgttagataa      2460
     agttaactct tatttttgaa ttttaaaatt tggatggggg ggtatgaact gctagagaaa      2520
     ataaagttct gccaaaatat tgcatatact                                       2550
//


spacer
spacer