spacer

EBI Dbfetch

ID   AK159886; SV 1; linear; mRNA; HTC; MUS; 1561 BP.
XX
AC   AK159886;
XX
DT   06-SEP-2005 (Rel. 85, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 11)
XX
DE   Mus musculus osteoclast-like cell cDNA, RIKEN full-length enriched library,
DE   clone:I420036I18 product:opioid receptor, sigma 1, full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1561
RA   Arakawa T., Carninci P., Fukuda S., Hashizume W., Hayashida K., Hori F.,
RA   Iida J., Imamura K., Imotani K., Itoh M., Kanagawa S., Kawai J., Kojima M.,
RA   Konno H., Murata M., Nakamura M., Ninomiya N., Nishiyori H., Nomura K.,
RA   Ohno M., Sakazume N., Sano H., Sasaki D., Shibata K., Shiraki T.,
RA   Tagami M., Tagami Y., Waki K., Watahiki A., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (30-MAR-2004) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; 59af7b8c7b31e434029185166ad401e9.
DR   Ensembl-Gn; ENSMUSG00000036078; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000059354; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000071561; mus_musculus.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Tissues were provided by Takashi Ishikawa  ( Department of Surgery
CC   2 Yokohama City University 3-9 Fukuura,Kanazawa-ku,Yokohama
CC   236-0004 Japan ) whose assistance we gratefully acknowledge.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=I420036I18
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1561
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="I420036I18"
FT                   /cell_type="osteoclast-like cell"
FT                   /db_xref="taxon:10090"
FT   CDS             42..713
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="opioid receptor, sigma 1 (MGD|MGI:1195268
FT                   GB|BC002000, evidence: BLASTN, 99%, match=1558)"
FT                   /note="putative"
FT                   /db_xref="GOA:O55242"
FT                   /db_xref="InterPro:IPR006716"
FT                   /db_xref="MGI:MGI:1195268"
FT                   /db_xref="UniProtKB/Swiss-Prot:O55242"
FT                   /protein_id="BAE35455.1"
FT                   /translation="MPWAAGRRWAWITLILTIIAVLIQAAWLWLGTQNFVFSREEIAQL
FT                   ARQYAGLDHELAFSRLIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCILHASLSEYV
FT                   LLFGTALGSHGHSGRYWAEISDTIISGTFHQWKEGTTKSEVFYPGETVVHGPGEATALE
FT                   WGPNTWMVEYGRGVIPSTLFFALADTFFSTQDYLTLFYTLRAYARGLRLELTTYLFGQD
FT                   S"
FT   polyA_signal    1548..1553
FT                   /note="putative"
FT   polyA_site      1561
FT                   /note="putative"
XX
SQ   Sequence 1561 BP; 340 A; 438 C; 415 G; 368 T; 0 other;
     ggtttcggtc ttacgttggt ggtgccaggc tgcccgctag aatgccgtgg gccgcgggac        60
     ggcggtgggc atggatcacc ctgattctga ctattatcgc agtgctgatc caggccgcct       120
     ggttgtggct gggcactcaa aacttcgtct tctctagaga agaaatagcg cagcttgctc       180
     gacagtatgc ggggctggac catgagcttg ccttctctcg gctgatcgtg gagctgcgga       240
     ggctgcaccc aggccacgtg ctgccggatg aggagctgca gtgggtattt gtgaacgcgg       300
     gcggctggat gggcgccatg tgtattctgc acgcctcgct gtctgagtac gtgctgctct       360
     tcggcaccgc cctgggctcc catggccatt cgggacgata ctgggctgag atttctgaca       420
     ccatcatctc tggcaccttc caccaatgga aagagggcac cacgaaaagt gaggtcttct       480
     acccaggaga gacagttgta cacgggcctg gagaagcaac ggctctggag tggggaccaa       540
     acacgtggat ggtggagtac ggccggggtg ttattccgtc taccctgttc tttgcactag       600
     ccgacacttt cttcagcacc caggactacc tcacactctt ctataccctt cgggcctatg       660
     cccggggcct ccggcttgag cttaccacct acctctttgg ccaagactcc tgaccagcca       720
     ggcctgaagg aagatctgtg gatggacagg agcgggcagg accacatcca tctctctact       780
     cgctggaact catattcaga cagcagcgta taccatgcag atattaagta cctgctgtat       840
     gaggaaggac atacatactt gtacatccag acacagctct tgggaagcaa atgagacaca       900
     gagatgctaa gacttgtatg tactgtaaga tcatgcactc acatccaccc agaaagggtc       960
     ctctacatat actccagggg gccagtcatg tttgaacaca catcacaagc ttgactcact      1020
     gactcaggct ttcctagagc ctcctgctgg cattcagggc tctgggatca agggttgagg      1080
     tagatgttac acattacctc actctgatgc ctcattcctg tagtaatctc tggtgaaggg      1140
     aaagaggagc tgcccttcgg aggtcccctt cacctgcagc tatgatgccc ttcccttcat      1200
     ccctttcctc accatatgcc ttatctccat tccactcccc tgctatgcaa atgcccccct      1260
     ggcttgtcct ccctgccccc cccggcaacc agttcagctg ggaaagcaga ggcatgtaga      1320
     ggatgctaaa gggaagggag gtcctccact acggagaccc ttgttggggt tagaatggga      1380
     aagctggcta gtgccccagg gccagttccc aaggagagga cctggagaag taagccgggg      1440
     tccaaggagc caccccattc caaaagaagc ctttagtgtg tgtgtgcaca ccctatcagt      1500
     ttccagacat atctgttgca atctctgtct tcttgtctct ctctgttaat aaaaacatat      1560
     t                                                                      1561
//


spacer
spacer