Dbfetch

ID   AK159584; SV 1; linear; mRNA; HTC; MUS; 1596 BP.
XX
AC   AK159584;
XX
DT   06-SEP-2005 (Rel. 85, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 11)
XX
DE   Mus musculus osteoclast-like cell cDNA, RIKEN full-length enriched library,
DE   clone:I420024P11 product:gamma-aminobutyric acid (GABA-B) receptor, 1, full
DE   insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1596
RA   Arakawa T., Carninci P., Fukuda S., Hashizume W., Hayashida K., Hori F.,
RA   Iida J., Imamura K., Imotani K., Itoh M., Kanagawa S., Kawai J., Kojima M.,
RA   Konno H., Murata M., Nakamura M., Ninomiya N., Nishiyori H., Nomura K.,
RA   Ohno M., Sakazume N., Sano H., Sasaki D., Shibata K., Shiraki T.,
RA   Tagami M., Tagami Y., Waki K., Watahiki A., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (30-MAR-2004) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science, e1252229 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science, e1252229 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; 66704d389d8b82dac1d6f15a413428af.
DR   Ensembl-Gn; ENSMUSG00000024462; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0023695; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0023653; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0023624; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0023660; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0023422; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0024098; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0022907; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0023399; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0023524; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0023497; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0023602; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0023520; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0024143; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0022659; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0022974; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000172789; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000174456; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0047663; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0047643; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0047604; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0047610; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0047342; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0048093; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0047404; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0047276; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0047375; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0047343; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0047477; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0047351; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0048188; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0046991; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0046665; mus_musculus_wsbeij.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Tissues were provided by Takashi Ishikawa  ( Department of Surgery
CC   2 Yokohama City University 3-9 Fukuura,Kanazawa-ku,Yokohama
CC   236-0004 Japan ) whose assistance we gratefully acknowledge.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=I420024P11
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1596
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="I420024P11"
FT                   /cell_type="osteoclast-like cell"
FT                   /db_xref="taxon:10090"
FT   CDS             264..953
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="gamma-aminobutyric acid (GABA-B) receptor, 1
FT                   (MGD|MGI:1860139 GB|BC054735, evidence: BLASTN, 100%,
FT                   match=734)"
FT                   /note="putative"
FT                   /db_xref="GOA:Q3TWR2"
FT                   /db_xref="InterPro:IPR000436"
FT                   /db_xref="MGI:MGI:1860139"
FT                   /db_xref="UniProtKB/TrEMBL:Q3TWR2"
FT                   /protein_id="BAE35204.1"
FT                   /translation="MLLLLLVPLFLRPLGAGGAQTPNVTSEGCQIIHPPWEGGIRYRGL
FT                   TRDQVKAINFLPVDYEIEYVCRGEREVVGPKVRKCLANGSWTDMDTPSRCVRICSKSYL
FT                   TLENGKVFLTGGDLPALDGARVDFRCDPDFHLVGSSRSICSQGQWSTPKPHCQGEGNSC
FT                   LPAADEGACPRMGVGWEWVEGMDGCYEECRGGVWEDAGETYLYTTHLPQTWFHGPFCWA
FT                   SPHPPFL"
XX
SQ   Sequence 1596 BP; 339 A; 424 C; 442 G; 391 T; 0 other;
     cccccggtcc ccggcgccgc ctccttccct cccggcaccg tgctctcgcg gccgccgtcg        60
     ccccggggaa ggagagacgg gggtggggtt tgcgggtagc gatcgcgaag gggagagacc       120
     ccggccgggc tggagcctgg attcctgtgg aagaagaaca gggggagggg aagctggagg       180
     accgggaggg agaacgggga gccgcggccg ggcctgggcc cttgaggccc ggggagagcc       240
     gcggagcggg accggccgcc gagatgctgc tgctgctgct ggtgcctctc ttcctccgcc       300
     ccctgggcgc tggcggggct cagaccccca acgtcacctc ggaaggttgc cagattatac       360
     atccgccctg ggaaggtggc atcaggtacc gtggcttgac tcgcgaccag gtgaaggcca       420
     tcaatttcct gcctgtggac tatgagattg aatatgtgtg ccggggcgaa cgcgaggtgg       480
     tggggcccaa ggtgcgcaag tgcctggcca acggctcctg gacggatatg gacacaccca       540
     gtcgctgtgt ccgaatctgc tccaagtctt atttgaccct ggaaaatggg aaggttttcc       600
     tgacgggtgg ggacctccca gctctggatg gagcccgggt ggatttccga tgtgaccccg       660
     acttccatct ggtgggcagc tcccggagca tctgtagtca gggccagtgg agcaccccca       720
     agccccactg ccagggtgag gggaacagct gcctgcctgc agctgatgag ggtgcctgcc       780
     ctagaatggg agtggggtgg gagtgggtag agggaatgga tggttgctat gaagaatgtc       840
     ggggaggagt ttgggaggat gcaggtgaaa cctatcttta caccacccac ctgcctcaga       900
     cttggttcca cggtcctttc tgttgggctt ccccccaccc tcctttcctt tagtgtgttc       960
     ttcctgattt caaatcttgg acctttttta tttttccttc attaatctca actccgcccc      1020
     cctcagcttc ttaaagttaa aaaactgctc tccccacctc cctggaaaaa actaccctcc      1080
     ccccccaccc cccgtagact tagaacatcc tctgtatcac tcttctagga ctggtccttt      1140
     gctattcact ctataatgga attgctgtaa atattcagaa ttaaatcata cattacattt      1200
     agaaaaagtc ggtgagatat gggattggaa acatggaaaa agcaaaaaaa ttggggcaga      1260
     atgaccagaa cagtgataat tcaagggcag atggaagaag actgagtctt gtgtatactt      1320
     taacaacctt gatcattcct tgagggaata attgattgct tttgtgtttg ctaccccctt      1380
     gcttgcctct ttgctgtctt ttctgcaaac gtctcccttt tctgggcacc caaactcttg      1440
     tatatatata ctcttctctc ctggaatgaa ttaagcttca gggttcttca ttttgactaa      1500
     gtccttattt tgagctctta agactgtgtg catatgctaa ccaacctttg gagaacttac      1560
     taaactaagg tatttaaaca gcacttattt aaaacc                                1596
//