Dbfetch

ID   AK159509; SV 1; linear; mRNA; HTC; MUS; 2882 BP.
XX
AC   AK159509;
XX
DT   06-SEP-2005 (Rel. 85, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 11)
XX
DE   Mus musculus osteoclast-like cell cDNA, RIKEN full-length enriched library,
DE   clone:I420022F22 product:valosin containing protein, full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2882
RA   Arakawa T., Carninci P., Fukuda S., Hashizume W., Hayashida K., Hori F.,
RA   Iida J., Imamura K., Imotani K., Itoh M., Kanagawa S., Kawai J., Kojima M.,
RA   Konno H., Murata M., Nakamura M., Ninomiya N., Nishiyori H., Nomura K.,
RA   Ohno M., Sakazume N., Sano H., Sasaki D., Shibata K., Shiraki T.,
RA   Tagami M., Tagami Y., Waki K., Watahiki A., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (30-MAR-2004) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science, e1252229 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science, e1252229 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; d0b2ae94a4137e605a245ce82acd0fb2.
DR   Ensembl-Gn; ENSMUSG00000028452; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000030164; mus_musculus.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Tissues were provided by Takashi Ishikawa  ( Department of Surgery
CC   2 Yokohama City University 3-9 Fukuura,Kanazawa-ku,Yokohama
CC   236-0004 Japan ) whose assistance we gratefully acknowledge.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=I420022F22
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2882
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="I420022F22"
FT                   /cell_type="osteoclast-like cell"
FT                   /db_xref="taxon:10090"
FT   CDS             302..2722
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="putative"
FT                   /note="valosin containing protein (MGD|MGI:99919
FT                   GB|BC049114, evidence: BLASTN, 100%, match=2858)"
FT                   /db_xref="GOA:Q01853"
FT                   /db_xref="InterPro:IPR003338"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR004201"
FT                   /db_xref="InterPro:IPR005938"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR015415"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029067"
FT                   /db_xref="MGI:MGI:99919"
FT                   /db_xref="PDB:1E32"
FT                   /db_xref="PDB:1R7R"
FT                   /db_xref="PDB:1S3S"
FT                   /db_xref="PDB:2PJH"
FT                   /db_xref="PDB:3CF0"
FT                   /db_xref="PDB:3CF1"
FT                   /db_xref="PDB:3CF2"
FT                   /db_xref="PDB:3CF3"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q01853"
FT                   /protein_id="BAE35141.1"
FT                   /translation="MASGADSKGDDLSTAILKQKNRPNRLIVDEAINEDNSVVSLSQPK
FT                   MDELQLFRGDTVLLKGKKRREAVCIVLSDDTCSDEKIRMNRVVRNNLRVRLGDVISIQP
FT                   CPDVKYGKRIHVLPIDDTVEGITGNLFEVYLKPYFLEAYRPIRKGDIFLVRGGMRAVEF
FT                   KVVETDPSPYCIVAPDTVIHCEGEPIKREDEEESLNEVGYDDIGGCRKQLAQIKEMVEL
FT                   PLRHPALFKAIGVKPPRGILLYGPPGTGKTLIARAVANETGAFFFLINGPEIMSKLAGE
FT                   SESNLRKAFEEAEKNAPAIIFIDELDAIAPKREKTHGEVERRIVSQLLTLMDGLKQRAH
FT                   VIVMAATNRPNSIDPALRRFGRFDREVDIGIPDATGRLEILQIHTKNMKLADDVDLEQV
FT                   ANETHGHVGADLAALCSEAALQAIRKKMDLIDLEDETIDAEVMNSLAVTMDDFRWALSQ
FT                   SNPSALRETVVEVPQVTWEDIGGLEDVKRELQELVQYPVEHPDKFLKFGMTPSKGVLFY
FT                   GPPGCGKTLLAKAIANECQANFISIKGPELLTMWFGESEANVREIFDKARQAAPCVLFF
FT                   DELDSIAKARGGNIGDGGGAADRVINQILTEMDGMSTKKNVFIIGATNRPDIIDPAILR
FT                   PGRLDQLIYIPLPDEKSRVAILKANLRKSPVAKDVDLEFLAKMTNGFSGADLTEICQRA
FT                   CKLAIRESIESEIRRERERQTNPSAMEVEEDDPVPEIRRDHFEEAMRFARRSVSDNDIR
FT                   KYEMFAQTLQQSRGFGSFRFPSGNQGGAGPSQGSGGGTGGSVYTEDNDDDLYG"
XX
SQ   Sequence 2882 BP; 707 A; 672 C; 803 G; 700 T; 0 other;
     gggttagagc agctttcctt ccgatgattc ggcttttctc ggttcagtct ccgtgaagcg        60
     tttgcagccg tcgtttgatt agtcgctgcc cccctcgcgg attaggagct agcgtctccc       120
     gcccgcccgc ctgccgcccc ggtgcccctg ggaggaagcg agagggaggc tgccagaggg       180
     tttgtcactg ctgttgctcc tccgcctcag cgagtccagc cccggcctag tcggtcgcct       240
     gcctttctca tagccgttac cctcaggccg ccacagccgc cgaccgggag aggcgcgcgc       300
     catggcctct ggagccgatt caaaaggtga tgatttatca acagccattc tcaaacagaa       360
     gaaccgaccc aatcggttaa ttgttgatga agccatcaat gaagataaca gcgtggtgtc       420
     cttgtcccag cccaagatgg atgaactgca gttgttccga ggtgacacgg tgttgctaaa       480
     aggaaagaaa agacgggaag ctgtatgcat tgttctttct gatgacacgt gttctgatga       540
     gaagattcga atgaatagag ttgttcggaa taacctccga gttcgcctag gagatgtcat       600
     cagcatccag ccatgccctg atgtaaagta tggcaaacgt atccacgttc tacccatcga       660
     tgacacagtg gaaggcatca ctggcaatct ctttgaggta taccttaagc cgtacttcct       720
     ggaagcttat cggcccatcc gtaaaggaga tatttttctt gtccggggtg ggatgcgtgc       780
     tgtggagttc aaagttgtag agacagatcc cagcccttac tgtattgttg ctccagacac       840
     agtgatccac tgtgaggggg agccaatcaa gcgagaggat gaggaggaat ccttgaatga       900
     agtaggctat gatgacatcg gtggttgcag gaagcagcta gctcagataa aggagatggt       960
     ggagctgcca ctgagacatc ctgcgctctt taaggcgatt ggtgtaaagc ctcctcgggg      1020
     aatcttgttg tatgggcctc ctgggacagg gaagaccctg attgctcgag ctgtggcaaa      1080
     tgaaactgga gccttcttct ttctgatcaa tggtcctgaa atcatgagca aattggctgg      1140
     tgagtctgag agcaaccttc gtaaagcctt tgaggaagct gaaaagaatg ctcctgctat      1200
     catcttcatc gatgagcttg atgccattgc acccaaaaga gagaaaactc atggggaagt      1260
     ggagcgtcgc atcgtgtctc agttgttgac cctcatggat ggcctaaagc agagagcaca      1320
     tgtgatagtt atggcagcaa ccaatagacc caacagcatt gacccagccc tacggcgatt      1380
     tggtcgcttt gacagagagg tagatattgg aatacctgat gctacaggac gtttggagat      1440
     tcttcagatc cataccaaga acatgaaact ggcagatgat gtggacttgg aacaggtagc      1500
     caatgagact catggtcatg ttggtgctga tttggcagcc ctatgttcag aggctgctct      1560
     gcaggccatc cggaaaaaaa tggacctcat tgacctagaa gatgagacca ttgatgctga      1620
     ggtcatgaat tccctggcag ttactatgga tgacttccgg tgggctttga gtcaaagcaa      1680
     cccatcagca cttcgggaaa ctgtggtaga ggtgccacaa gtaacctggg aagatattgg      1740
     aggcctggag gatgtcaaac gtgagcttca ggagttggtt cagtatcctg tggaacatcc      1800
     agacaaattc ctcaaatttg gcatgactcc ctccaaaggc gttcttttct atggacctcc      1860
     tggctgtggg aaaaccttac tggctaaagc cattgctaat gaatgccagg ccaacttcat      1920
     ctccatcaag ggtcctgagc tgcttaccat gtggtttggg gaatctgagg ccaatgtccg      1980
     ggaaattttt gacaaggcac ggcaagctgc cccctgtgta ctcttctttg atgagttaga      2040
     ttcaattgcc aaggctcgag gtggtaatat tggagatggt ggtggagctg ctgaccgagt      2100
     catcaatcag atcctgacag aaatggatgg catgtctaca aaaaagaatg tgtttatcat      2160
     tggagctacc aacaggcctg acatcattga tcctgctatc ctaagacctg gccgtctaga      2220
     tcagctcatt tatatcccac ttcctgatga gaagtcccgt gttgccatcc taaaagccaa      2280
     tctgcgaaag tccccagttg ccaaggatgt ggatttggag ttcctggcta agatgactaa      2340
     tggcttttct ggagctgatt tgacagaaat ttgccaacgg gcttgtaaac tggccattcg      2400
     tgaatctatt gagagtgaga ttaggcgaga acgagagagg cagacaaatc catcggctat      2460
     ggaggtagaa gaggacgatc cagtgcctga gatccgcaga gatcactttg aggaagccat      2520
     gcgttttgcc cgacgttctg tcagcgataa tgacattcgg aagtatgaaa tgttcgccca      2580
     gacactgcag cagagtcgag gttttggcag cttcagattc ccttcaggga accagggtgg      2640
     agctggtccc agccagggca gtggaggtgg cacaggtggc agtgtgtaca cagaagacaa      2700
     tgacgatgac ctgtatggct aagtgatgtg ccagcatgca gcgagctggc ctggctggac      2760
     cttgttccct gggggagggg gcgcttgccc aagagggacc aggggtgtgc ccatggcctg      2820
     ttccattcct cagtctgaac agttcagccc cagtcagact ctggacaggg gtttcctgtt      2880
     gc                                                                     2882
//