spacer

EBI Dbfetch

ID   AK159452; SV 1; linear; mRNA; HTC; MUS; 2013 BP.
XX
AC   AK159452;
XX
DT   06-SEP-2005 (Rel. 85, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 11)
XX
DE   Mus musculus osteoclast-like cell cDNA, RIKEN full-length enriched library,
DE   clone:I420020G13 product:cysteine rich protein 61, full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2013
RA   Arakawa T., Carninci P., Fukuda S., Hashizume W., Hayashida K., Hori F.,
RA   Iida J., Imamura K., Imotani K., Itoh M., Kanagawa S., Kawai J., Kojima M.,
RA   Konno H., Murata M., Nakamura M., Ninomiya N., Nishiyori H., Nomura K.,
RA   Ohno M., Sakazume N., Sano H., Sasaki D., Shibata K., Shiraki T.,
RA   Tagami M., Tagami Y., Waki K., Watahiki A., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (30-MAR-2004) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; 8b84d4f528829a87f7d3977a3c3a533c.
DR   Ensembl-Gn; ENSMUSG00000028195; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000029846; mus_musculus.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Tissues were provided by Takashi Ishikawa  ( Department of Surgery
CC   2 Yokohama City University 3-9 Fukuura,Kanazawa-ku,Yokohama
CC   236-0004 Japan ) whose assistance we gratefully acknowledge.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=I420020G13
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2013
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="I420020G13"
FT                   /cell_type="osteoclast-like cell"
FT                   /db_xref="taxon:10090"
FT   CDS             186..1325
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="cysteine rich protein 61 (MGD|MGI:88613
FT                   GB|NM_010516, evidence: BLASTN, 99%, match=2012)"
FT                   /note="putative"
FT                   /db_xref="GOA:Q3TX21"
FT                   /db_xref="InterPro:IPR000867"
FT                   /db_xref="InterPro:IPR000884"
FT                   /db_xref="InterPro:IPR001007"
FT                   /db_xref="InterPro:IPR006207"
FT                   /db_xref="InterPro:IPR006208"
FT                   /db_xref="InterPro:IPR009030"
FT                   /db_xref="InterPro:IPR012395"
FT                   /db_xref="InterPro:IPR017891"
FT                   /db_xref="MGI:MGI:88613"
FT                   /db_xref="UniProtKB/TrEMBL:Q3TX21"
FT                   /protein_id="BAE35095.1"
FT                   /translation="MSSSTFRTLAVAVTLLHLTRLALSTCPAACHCPLEAPKCAPGVGL
FT                   VRDGCGCCKVCAKQLNEDCSKTQPCDHTKGLECNFGASSTALKGICRAQSEGRPCEYNS
FT                   RIYQNGESFQPNCKHQCTCIDGAVGCIPLCPQELSLPNLGCPNPRLVKVSGQCCEEWVC
FT                   DEDSIKDSLDDQDDLLGLDASEVELTRNNELIAIGKGSSLKRLPVFGTEPRVLFNPLHA
FT                   HGQKCIVQTTSWSQCSKSCGTGISTRVTNDNPECRLVKETRICEVRPCGQPVYSSLKKG
FT                   KKCSKTKKSPEPVRFTYAGCSSVKKYRPKYCGSCVDGRCCTPLQTRTVKMRFRCEDGEM
FT                   FSKNVMMIQSCKCNYNCPHPNEASFRLYSLFNDIHKFRD"
FT   polyA_signal    1995..2000
FT                   /note="putative"
FT   polyA_site      2013
FT                   /note="putative"
XX
SQ   Sequence 2013 BP; 495 A; 535 C; 528 G; 455 T; 0 other;
     ggtgagcgag agcgccccag agaagcgcct gcaatctctg cgcctcctcc gccagcacct        60
     cgagagaagg acacccgccg cctcggccct cgcctcaccg cactccgggc gcatttgatc       120
     ccgctgctcg ccggcttgtt ggttctgtgt cgccgcgctc gccccggttc ctcctgcgcg       180
     ccacaatgag ctccagcacc ttcaggacgc tcgctgtcgc cgtcaccctt ctccacttga       240
     ccagactggc gctctccacc tgccccgccg cctgccactg ccctctggag gcacccaagt       300
     gcgccccggg agtcgggttg gtccgggacg gctgcggctg ctgtaaggtc tgcgctaaac       360
     aactcaacga ggactgcagc aaaactcagc cctgcgacca caccaagggg ttggaatgca       420
     atttcggcgc cagctccacc gctctgaaag ggatctgcag agctcagtca gaaggcagac       480
     cctgtgaata taactccaga atctaccaaa acggggaaag cttccagccc aactgtaaac       540
     accagtgcac atgtattgat ggcgccgtgg gctgcattcc tctgtgtccc caagaactgt       600
     ctctccccaa tctgggctgt cccaaccccc ggctggtgaa agtcagcggg cagtgctgtg       660
     aagagtgggt ttgtgatgaa gacagcatta aggactccct ggacgaccag gatgacctcc       720
     tcggactcga tgcctcggag gtggagttaa cgagaaacaa tgagttaatc gcaattggaa       780
     aaggcagctc actgaagagg cttcctgtct ttggcaccga accgcgagtt cttttcaacc       840
     ctctgcacgc ccatggccag aaatgcatcg ttcagaccac gtcttggtcc cagtgctcca       900
     agagctgcgg aactggcatc tccacacgag ttaccaatga caacccagag tgccgcctgg       960
     tgaaagagac ccggatctgt gaagtgcgtc cttgtggaca accagtgtac agcagcctaa      1020
     aaaagggcaa gaaatgcagc aagaccaaga aatccccaga accagtcaga tttacttatg      1080
     caggatgctc cagtgtcaag aaataccggc ccaaatactg cggctcctgc gtagatggcc      1140
     ggtgctgcac acctctgcag accagaactg tgaagatgcg gttccgatgc gaagatggag      1200
     agatgttttc caagaatgtc atgatgatcc agtcctgcaa atgtaactac aactgcccgc      1260
     atcccaacga ggcatcgttc cgactgtaca gcctattcaa tgacatccac aagttcaggg      1320
     actaagtgcc tccagggttc ctagtgtggg ctggacagag gagaagcgca agcatcatgg      1380
     agacgtgggt gggcggagga tgaatggtgc cttgctcatt cttgagtagc attagggtat      1440
     ttcaaaactg ccaaggggct gatgtggacg gacagcagcg cagccgcagt tggagaatgc      1500
     caaggggctg atgtggacgg acagcagcgc agccgcagtt ggagaagact tcgcttcata      1560
     gtactggagc gggcattatt gctccatatt ggagcatgtt tacggatgac gttctgtttt      1620
     ctgtttgtaa attatttgct aagtgtattt ttttgctcca gacccccccc cccctttctt      1680
     ggttctacaa ttgtaataga gacaaaataa gattagttgg gccaagtgaa agccctgctt      1740
     gtcctttgac agaagtaaat gaaagcgcct ctcattcctt cccgagcgga ggggggacac      1800
     tctgtgagtg tccttggggc agctacctgc actctaaaac tgcaaacaga aaccaggtgt      1860
     tttaagattg aatgtttttt tatttatcaa agtgtagctt ttggggaggg aggggaaatg      1920
     taatactgga ataatttgta aatgatttta attttatatc agtgaagaga atttatttat      1980
     aaaattaatc atttaataaa gaaatattta cct                                   2013
//


spacer
spacer