spacer

EBI Dbfetch

ID   AK159362; SV 1; linear; mRNA; HTC; MUS; 3257 BP.
XX
AC   AK159362;
XX
DT   06-SEP-2005 (Rel. 85, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 11)
XX
DE   Mus musculus osteoclast-like cell cDNA, RIKEN full-length enriched library,
DE   clone:I420018F21 product:UDP-N-acetyl-alpha-D- galactosamine:polypeptide
DE   N-acetylgalactosaminyltransferase 10, full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-3257
RA   Arakawa T., Carninci P., Fukuda S., Hashizume W., Hayashida K., Hori F.,
RA   Iida J., Imamura K., Imotani K., Itoh M., Kanagawa S., Kawai J., Kojima M.,
RA   Konno H., Murata M., Nakamura M., Ninomiya N., Nishiyori H., Nomura K.,
RA   Ohno M., Sakazume N., Sano H., Sasaki D., Shibata K., Shiraki T.,
RA   Tagami M., Tagami Y., Waki K., Watahiki A., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (30-MAR-2004) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; 6978e69269fb59f28696a314fee7f258.
DR   Ensembl-Gn; ENSMUSG00000020520; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000066987; mus_musculus.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Tissues were provided by Takashi Ishikawa  ( Department of Surgery
CC   2 Yokohama City University 3-9 Fukuura,Kanazawa-ku,Yokohama
CC   236-0004 Japan ) whose assistance we gratefully acknowledge.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=I420018F21
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3257
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="I420018F21"
FT                   /cell_type="osteoclast-like cell"
FT                   /db_xref="taxon:10090"
FT   CDS             116..1927
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="UDP-N-acetyl-alpha-D-galactosamine:polypeptide
FT                   N-acetylgalactosaminyltransferase 10 (MGD|MGI:1890480
FT                   GB|BC060617, evidence: BLASTN, 99%, match=3242)"
FT                   /note="putative"
FT                   /db_xref="GOA:Q5SQF9"
FT                   /db_xref="InterPro:IPR000772"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="MGI:MGI:1890480"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SQF9"
FT                   /protein_id="BAE35020.1"
FT                   /translation="MRRKEKRLLQAVALALAALVLLPNVGLWALYRERQPDGSPGGLGA
FT                   AVAPAAVQELHSRQKKTFFLGAEQRLKDWHNKEAIRRDAQRVGYGEQGKPYPMTDAERV
FT                   DQAYRENGFNIYVSDKISLNRSLPDIRHPNCNSKLYLETLPNTSIIIPFHNEGWSSLLR
FT                   TVHSVLNRSPPELVAEIVLVDDFSDREHLKKPLEDYMALFPSVRILRTKKREGLIRTRM
FT                   LGASAATGDVVTFLDSHCEANVNWLPPLLDRIARNRKTIVCPMIDVIDHDDFRYETQAG
FT                   DAMRGAFDWEMYYKRIPIPPELQKADPSDPFESPVMAGGLFAVDRKWFWELGGYDPGLE
FT                   IWGGEQYEISFKVWMCGGRMEDIPCSRVGHIYRKYVPYKVPAGVSLARNLKRVAEVWMD
FT                   EYAEYIYQRRPEYRHLSAGDVVAQKKLRVSLNCKSFKWFMTKIAWDLPKFYPPVEPPAA
FT                   AWGEIRNVGTGLCTDTKLGTLGSPLRLETCIRGRGEAAWNSMQVFTFTWREDIRPGDPQ
FT                   HTKKFCFDAVSHTSPVTLYDCHSMKGNQLWKYRKDKTLYHPVSGSCMDCSESDHRVFMN
FT                   TCNPSSLTQQWLFEHTNSTVLENFNKN"
FT   polyA_signal    3233..3238
FT                   /note="putative"
FT   polyA_site      3257
FT                   /note="putative"
XX
SQ   Sequence 3257 BP; 718 A; 917 C; 972 G; 650 T; 0 other;
     ggttggagcg gggccggcgt cgcggccgct actgctggcc gaactgctgc cgccgccggg        60
     tggacgggcg gacgcgcaaa gccgggggcg ggcgcggcgg ggcggaccgg ccccgatgag       120
     gcgcaaagag aagcggctct tgcaggcggt ggctctggct ctggcggccc tggtcctgct       180
     gcccaacgtg gggctttggg ctctgtaccg cgagcggcag cccgacggca gccctggggg       240
     attgggggcg gcggtggccc ccgcggcggt tcaggaatta cacagtcgac aaaaaaagac       300
     atttttcttg ggagctgaac aaaggctgaa ggactggcat aacaaggagg ctatcaggag       360
     ggacgcacag cgcgtaggat atggagaaca ggggaagcct taccccatga ccgatgccga       420
     gagagtggac caggcgtacc gggaaaatgg atttaacatc tacgtcagtg ataaaatctc       480
     cctgaatcgc tctctccccg atatccggca cccaaactgt aacagcaagc tctacctgga       540
     gacgctcccc aacaccagca tcatcatccc cttccacaac gagggctggt cctcactgct       600
     gcgcactgtt cacagcgtgc tcaaccgctc gcccccagag ctagtggcgg agattgtgtt       660
     ggtcgatgac ttcagtgatc gagagcacct gaagaagccc ctggaggact acatggccct       720
     tttccccagc gtgaggattc tccggaccaa gaaacgggaa ggcctgataa ggacccgaat       780
     gctgggggca tcagctgcca ccggagatgt cgtcactttc ttagattcac actgtgaagc       840
     caacgtcaac tggctccccc ctttgcttga ccgcattgct cggaaccgga agaccatcgt       900
     gtgcccaatg atcgatgtca tcgaccacga tgacttccgg tatgagactc aggctgggga       960
     cgccatgcgt ggtgccttcg actgggaaat gtattacaaa cggatcccaa tccctccaga      1020
     gctgcagaag gctgacccca gtgacccatt tgagtctccc gtgatggctg gagggttgtt      1080
     cgctgtggac cggaaatggt tctgggagtt gggtggctat gaccctggct tggagatctg      1140
     gggaggagag cagtatgaga tctccttcaa ggtgtggatg tgtgggggcc gcatggagga      1200
     catcccctgc tccagagtgg gccacatcta caggaagtat gtgccctaca aggtccctgc      1260
     cggagtcagc ctggcccgga acctgaagcg agtggcagag gtatggatgg atgaatacgc      1320
     agaatacatc taccagcgca ggccggagta ccgccacctc tcagctggag atgtcgtggc      1380
     ccagaaaaag ctccgagtct ccctcaactg taagagcttc aagtggttta tgaccaaaat      1440
     tgcctgggac ctgcccaagt tctacccacc cgtggaacct ccggctgcgg catgggggga      1500
     gattcgcaat gtgggcacag gactgtgcac agacacgaag cttggcacac tgggctcccc      1560
     actgaggctc gagacctgca tccggggccg aggcgaggct gcttggaaca gtatgcaggt      1620
     ctttaccttc acctggcggg aggacatccg gcctggagac cctcagcaca ccaagaagtt      1680
     ttgcttcgac gctgtctccc acaccagccc agtcaccctc tacgactgcc acagcatgaa      1740
     gggcaaccag ctgtggaaat accgcaagga caagacgctg taccaccctg tgagcggcag      1800
     ctgcatggac tgcagcgaga gtgaccacag ggtcttcatg aacacctgca atccctcctc      1860
     cctcacccag cagtggctct ttgaacacac caactcgacg gtcttagaga atttcaacaa      1920
     gaactgagtc cttagacctt gacaaacccc tcaggttcct gtggagctca taaaccttcc      1980
     tcctgtggga gaagaggcat cggtgggcac caaggtgctg ggttcttgaa ggactgacat      2040
     ggtggggcca cggggagaac agaccatacc aatggctctc caagaaggcg gagcctgctc      2100
     acatcatagc agagctcacc agcctgtcag catgttccct aagtgttagg aatcgcctgg      2160
     gcagccttga gccatgaggt tgcccttgca gacaggacag tgccctagaa aggaaggtgg      2220
     tatcggcctt gggacagctt aaacctgtgt gccagctgct ggcaaggaag tctgcctgtt      2280
     cttgagggaa ctgctagaat tgcccagctt ctgtgttggt ccagggcaat gagaggccat      2340
     tgggacttcc gagtgctcca tagctagcac tggccagcaa ccaggcgagg ggccccttcc      2400
     tctgcagcca gatgtaaagg atgtctcccc tggctctctg ggtatttcag atgcccgttc      2460
     tagtttcagg gctacctggg caccaggtcg tcagggctag ttcagccggc taagtagacc      2520
     tccagaccga acagctccca gccaatgctt ccaaagccct ttctccgtgc ttttccttgg      2580
     cggctccctg ccttggagag gaaccggtgc tgtgagggat cacctccaga gtctcctggg      2640
     gggtggtttc ccccagataa tgactgctgt ggttccaacc tcacagaacc ctggagtttc      2700
     tggaaagttc tgtggttctg ttgaaagcat agatgagcca tggcacgtgt gggcatataa      2760
     cgcaagcagc caggtgtcag gcaacccctg acccaagcag aggcggtagg gcaccagaag      2820
     cttcggtcca acccaatgcc gtcacagcca cagcctcgtg aggtgtgagg acatcacctt      2880
     tagccccatg tctcaaacat gaactcaccc tccaaggagc tggtcacttg ccagtgaagt      2940
     aactgagaca tggtcctgag gccagagctc tgccttagag atgctgggat cggggtcatc      3000
     gggtccccag gctcgtcggg ttggtgctgt agaaccacct ccacgtagcc cctgtgctgt      3060
     cacagctcac ttgtggattt ctagtgccct tttccatatg agcactctgt ctgacaagtg      3120
     gccggctggg aaggagtcaa aaaggggagt gggtgggtgt ccagaatcca gcagggatgc      3180
     gtgttgcagc caaggggagt tgagtcctca gagagcaatg cggccttgtt tcaataaaaa      3240
     ccgtgccttt tacaaag                                                     3257
//


spacer
spacer