spacer

EBI Dbfetch

ID   AK159294; SV 1; linear; mRNA; HTC; MUS; 3278 BP.
XX
AC   AK159294;
XX
DT   06-SEP-2005 (Rel. 85, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 11)
XX
DE   Mus musculus osteoclast-like cell cDNA, RIKEN full-length enriched library,
DE   clone:I420015B21 product:solute carrier family 40 (iron-regulated
DE   transporter), member 1, full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-3278
RA   Arakawa T., Carninci P., Fukuda S., Hashizume W., Hayashida K., Hori F.,
RA   Iida J., Imamura K., Imotani K., Itoh M., Kanagawa S., Kawai J., Kojima M.,
RA   Konno H., Murata M., Nakamura M., Ninomiya N., Nishiyori H., Nomura K.,
RA   Ohno M., Sakazume N., Sano H., Sasaki D., Shibata K., Shiraki T.,
RA   Tagami M., Tagami Y., Waki K., Watahiki A., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (30-MAR-2004) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; 510a2d3085b34cf06f14c79d0d6f3e1f.
DR   Ensembl-Gn; ENSMUSG00000025993; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000027137; mus_musculus.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Tissues were provided by Takashi Ishikawa  ( Department of Surgery
CC   2 Yokohama City University 3-9 Fukuura,Kanazawa-ku,Yokohama
CC   236-0004 Japan ) whose assistance we gratefully acknowledge.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=I420015B21
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3278
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="I420015B21"
FT                   /cell_type="osteoclast-like cell"
FT                   /db_xref="taxon:10090"
FT   CDS             321..2033
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="putative"
FT                   /note="solute carrier family 40 (iron-regulated
FT                   transporter), member 1 (MGD|MGI:1315204 GB|BC003438,
FT                   evidence: BLASTN, 99%, match=3258)"
FT                   /db_xref="GOA:Q9JHI9"
FT                   /db_xref="InterPro:IPR009716"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="MGI:MGI:1315204"
FT                   /protein_id="BAE34969.1"
FT                   /translation="MTKARDQTHQEGCCGSLANYLTSAKFLLYLGHSLSTWGDRMWHFA
FT                   VSVFLVELYGNSLLLTAVYGLVVAGSVLVLGAIIGDWVDKNARLKVAQTSLVVQNVSVI
FT                   LCGIILMMVFLHKNELLTMYHGWVLTVCYILIITIANIANLASTATAITIQRDWIVVVA
FT                   GENRSRLADMNATIRRIDQLTNILAPMAVGQIMTFGSPVIGCGFISGWNLVSMCVEYFL
FT                   LWKVYQKTPALAVKAALKVEESELKQLTSPKDTEPKPLEGTHLMGEKDSNIRELECEQE
FT                   PTCASQMAEPFRTFRDGWVSYYNQPVFLAGMGLAFLYMTVLGFDCITTGYAYTQGLSGS
FT                   ILSILMGASAITGIMGTVAFTWLRRKCGLVRTGLFSGLAQLSCLILCVISVFMPGSPLD
FT                   LSVSPFEDIRSRFVNVEPVSPTTKIPETVFTTEMHMSNMSNVHEMSTKPIPIVSVSLLF
FT                   AGVIAARIGLWSFDLTVTQLLQENVIESERGIINGVQNSMNYLLDLLHFIMVILAPNPE
FT                   AFGLLVLISVSFVAMGHLMYFRFAQKTLGNQIFVCGPDEKEVTDENQPNTSVV"
XX
SQ   Sequence 3278 BP; 861 A; 697 C; 742 G; 978 T; 0 other;
     gggcggcggc ggcggcggcg gcgagagcag gctcggggtc tcctgcggcc ggtggatcct        60
     ccaacccgct cccataaggc tttggctttc caacttcagc tacagtgtta gctaagtttg       120
     gaaagaagac aaaaagaaga ccccgtgaca gctttgctgt tgttgtttgc cttagttgtc       180
     ctttggggtc tttcggcata aggctgttgt gcttatactg gtgctatctt cggttcctct       240
     cactcctgtg aacaagctcc cgggcaagag cagctaaagc taccagcatc agaacaaaca       300
     aggggagaac gcctggtgtc atgaccaagg caagagatca aacccatcag gaaggatgct       360
     gtggatcctt agcaaactac ctgacctcag caaaattcct cctctacctt ggccactctc       420
     tctccacttg gggggatcgg atgtggcact ttgcagtgtc tgtgtttctg gtggaactct       480
     atggaaacag ccttctcttg acagctgtct atggactggt ggtggcaggc tctgttctgg       540
     tcctgggagc catcattggt gactgggtgg ataagaatgc cagacttaaa gtggcccaga       600
     cgtcactggt ggttcagaat gtgtccgtca tcctctgcgg aatcatcctg atgatggttt       660
     tcctacacaa gaatgagctc ctgaccatgt accatggatg ggtccttact gtctgctaca       720
     tcctgatcat cactattgca aacattgcaa atttggccag tactgccact gcgatcacaa       780
     tccaaaggga ctggattgtt gttgtggcag gagaaaacag gagcagatta gcagacatga       840
     atgctaccat tagaaggatt gaccagctaa ccaacatcct ggcccccatg gctgtcggcc       900
     agattatgac atttggttct ccagtcattg gctgtggttt tatttccggt tggaatttgg       960
     tgtccatgtg tgtggagtac ttcttgctct ggaaggttta ccagaagacc cctgctctgg      1020
     ctgtaaaagc tgctctcaag gtagaggagt cagaactgaa gcagctgacc tcacctaaag      1080
     atactgagcc aaaacctttg gagggaactc atctaatggg tgagaaagac tccaacatcc      1140
     gtgaacttga atgtgaacaa gagcccacct gtgcctccca gatggcagag cccttccgca      1200
     ctttccgaga tggatgggtc tcctactata accagccagt gtttctggct ggcatgggcc      1260
     tggctttcct ctatatgaca gtcctgggct ttgactgtat cactacaggg tacgcctaca      1320
     ctcaggggct gagtggatcc atccttagta ttttgatggg agcatcagca ataactggaa      1380
     taatgggaac tgtggccttc acctggctac gtcgaaaatg tggccttgtt cggactggtc      1440
     tattctcagg actagcccag ctttcctgtt taatcttgtg tgtgatctcc gtattcatgc      1500
     ctggaagccc cttggacctg tctgtttctc catttgaaga tatccgttct aggtttgtga      1560
     atgtggagcc agtgtcccca actaccaaaa tacctgagac cgtctttaca acagaaatgc      1620
     atatgtccaa catgtctaat gtccatgaga tgagtactaa acccatcccc atagtctctg      1680
     tcagcctgct gtttgcagga gtcattgctg ctagaatcgg tctttggtcc tttgatttga      1740
     cggtgacaca gttgctgcaa gaaaatgtaa ttgaatctga aagaggcatt atcaatggtg      1800
     tgcagaactc catgaactac cttcttgacc ttctgcattt catcatggtc atcttggccc      1860
     caaatcctga agcttttggc ttgctggtat tgatttcagt ctcctttgtg gcaatgggac      1920
     atcttatgta tttccgattt gcccagaaga ctctgggcaa ccagattttt gtttgtggtc      1980
     ctgatgaaaa agaagttaca gatgaaaatc aaccgaatac atctgttgta taaaaatagt      2040
     ttagctgtgg cccctgttac tagattgtgg agagcatgtg tgcttatttt gtactgcaga      2100
     atcccaataa atgcctgcat ttctctctgg ttttaccaca tctgtgcctt aagggctagg      2160
     agcactaact aaccatcgcc agcaaagatg gttatttctc cttacatgta aacattggaa      2220
     aataggaaga gggagaggca gtcagcgtgt gtataggaag ggtttaatgg taaaatgaac      2280
     ttcccttact cttatgagta tattaaattt taaagagtgg ttgtcaggtg agtaaaatta      2340
     ttccttagca gatatttatt atctactgga atgataaatc aattcaccct aaaactcact      2400
     cttgtaaaac tctgctccac ttcctttttt taagatcagt gatatttttc tcagttacat      2460
     tacagaaaca agtttttcct ccatgtatga aggttatagt tagataatga atgttatcct      2520
     tattaatccc attgaactta aggaatttat tgtatgtgga ggatgaaatg tgtaactaga      2580
     cttgtccaaa aggttcatgg aataactttt gcattttgac catcagaaag ggcaaaatat      2640
     tacagtaatg tgtgtatggt ggctcttcat aaaatgactc tcaaaatctg cagaaagaag      2700
     aaaagttgta ggtttctagt gtggtacaga aggacttaaa gcttgttatt agtgtgattg      2760
     tagaaactgg aagctaaggg tgaggacctc atgtaaccag agtcactgtc atcagccatc      2820
     actaactatt ttggtaaatg agagaactga cctggcacct tacaagcaga aaagcggccc      2880
     acactaagaa aggactgcaa atcagtgagt ctgtatagaa cattttacct tcactgactt      2940
     gggccgatgt gtttgtcatc tctgtgtttt tctagagcaa gaatagtcac aaaagttccc      3000
     ctttcaatat ccctgagaag aataaagaaa aaactgtttg taaatatttt tttaaaactg      3060
     ttctgcaagt ctttttgtaa catgcagtac caacatggga cattgcctta acttttgatg      3120
     cactttcatg gagactgact gccatgcatt gctgtgagca ctttctttgt cgttcagttt      3180
     aatcttttcc ttcaccttta ttacagtatg acataatgat ctattatgtt gtcaaagctt      3240
     cataaaatat ttctatataa aatgtttgta gaatcttc                              3278
//


spacer
spacer