spacer

EBI Dbfetch

ID   AK159292; SV 1; linear; mRNA; HTC; MUS; 2442 BP.
XX
AC   AK159292;
XX
DT   06-SEP-2005 (Rel. 85, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 11)
XX
DE   Mus musculus osteoclast-like cell cDNA, RIKEN full-length enriched library,
DE   clone:I420014N23 product:matrix metalloproteinase 9, full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2442
RA   Arakawa T., Carninci P., Fukuda S., Hashizume W., Hayashida K., Hori F.,
RA   Iida J., Imamura K., Imotani K., Itoh M., Kanagawa S., Kawai J., Kojima M.,
RA   Konno H., Murata M., Nakamura M., Ninomiya N., Nishiyori H., Nomura K.,
RA   Ohno M., Sakazume N., Sano H., Sasaki D., Shibata K., Shiraki T.,
RA   Tagami M., Tagami Y., Waki K., Watahiki A., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (30-MAR-2004) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; 9f50f14d890789d5f98acf42b9f528b5.
DR   Ensembl-Gn; ENSMUSG00000017737; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000017881; mus_musculus.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Tissues were provided by Takashi Ishikawa  ( Department of Surgery
CC   2 Yokohama City University 3-9 Fukuura,Kanazawa-ku,Yokohama
CC   236-0004 Japan ) whose assistance we gratefully acknowledge.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=I420014N23
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2442
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="I420014N23"
FT                   /cell_type="osteoclast-like cell"
FT                   /db_xref="taxon:10090"
FT   CDS             21..2213
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="matrix metalloproteinase 9 (MGD|MGI:97011
FT                   GB|AK004651, evidence: BLASTN, 99%, match=2436)"
FT                   /note="putative"
FT                   /db_xref="GOA:P41245"
FT                   /db_xref="InterPro:IPR000562"
FT                   /db_xref="InterPro:IPR000585"
FT                   /db_xref="InterPro:IPR001818"
FT                   /db_xref="InterPro:IPR002477"
FT                   /db_xref="InterPro:IPR006026"
FT                   /db_xref="InterPro:IPR006970"
FT                   /db_xref="InterPro:IPR013806"
FT                   /db_xref="InterPro:IPR018486"
FT                   /db_xref="InterPro:IPR018487"
FT                   /db_xref="InterPro:IPR021158"
FT                   /db_xref="InterPro:IPR021190"
FT                   /db_xref="InterPro:IPR024079"
FT                   /db_xref="InterPro:IPR028688"
FT                   /db_xref="MGI:MGI:97011"
FT                   /db_xref="UniProtKB/Swiss-Prot:P41245"
FT                   /protein_id="BAE34968.1"
FT                   /translation="MSPWQPLLLALLAFGCSSAAPYQRQPTFVVFPKDLKTSNLTDTQL
FT                   AEAYLYRYGYTRAAQMMGEKQSLRPALLMLQKQLSLPQTGELDSQTLKAIRTPRCGVPD
FT                   VGRFQTFKGLKWDHHNITYWIQNYSEDLPRDMIDDAFARAFAVWGEVAPLTFTRVYGPE
FT                   ADIVIQFGVAEHGDGYPFDGKDGLLAHAFPPGAGVQGDAHFDDDELWSLGKGVVIPTYY
FT                   GNSNGAPCHFPFTFEGRSYSACTTDGRNDGTPWCSTTADYDKDGKFGFCPSERLYTEHG
FT                   NGEGKPCVFPFIFEGRSYSACTTKGRSDGYRWCATTANYDQDKLYGFCPTRVDATVVGG
FT                   NSAGELCVFPFVFLGKQYSSCTSDGRRDGRLWCATTSNFDTDKKWGFCPDQGYSLFLVA
FT                   AHEFGHALGLDHSSVPEALMYPLYSYLEGFPLNKDDIDGIQYLYGRGSKPDPRPPATTT
FT                   TEPQPTAPPTMCPTIPPTAYPTVGPTVGPTGAPSPGPTSSPSPGPTGAPSPGPTAPPTA
FT                   GSSEASTESLSPADNPCNVDVFDAIAEIQGALHFFKDGWYWKFLNHRGSPLQGPFLTAR
FT                   TWPALPATLDSAFEDPQTKRVFFFSGRQMWVYTGKTVLGPRSLDKLGLGPEVTHVSGLL
FT                   PRRLGKALLFSKGRVWRFDLKSQKVDPQSVIRVDKEFSGVPWNSHDIFQYQDKAYFCHG
FT                   KFFWRVSFQNEVNKVDHEVNQVDDVGYVTYDLLQCP"
XX
SQ   Sequence 2442 BP; 505 A; 768 C; 651 G; 518 T; 0 other;
     gagatgctgc ggtcctcacc atgagtccct ggcagcccct gctcctggct ctcctggctt        60
     tcggctgcag ctctgctgcc ccttaccagc gccagccgac ttttgtggtc ttccccaaag       120
     acctgaaaac ctccaacctc acggacaccc agctggcaga ggcatacttg taccgctatg       180
     gttacacccg ggccgcccag atgatgggag agaagcagtc tctacggccg gctttgctga       240
     tgcttcagaa gcagctctcc ctgccccaga ctggtgagct ggacagccag acactaaagg       300
     ccattcgaac accacgctgt ggtgtcccag acgtgggtcg attccaaacc ttcaaaggcc       360
     tcaagtggga ccatcataac atcacatact ggatccaaaa ctactctgaa gacttgccgc       420
     gagacatgat cgatgacgcc ttcgcgcgcg ccttcgcggt gtggggcgag gtggcacccc       480
     tcaccttcac ccgcgtgtac ggacccgaag cggacattgt catccagttt ggtgtcgcgg       540
     agcacggaga cgggtatccc ttcgacggca aggacggcct tctggcacac gcctttcccc       600
     ctggcgccgg cgttcaggga gatgcccatt tcgacgacga cgagttgtgg tcgctgggca       660
     aaggcgtcgt gatccccact tactatggaa actcaaatgg tgccccatgt cactttccct       720
     tcaccttcga gggacgctcc tattcggcct gcaccacaga cggccgcaac gacggcacgc       780
     cttggtgtag cacaacagct gactacgata aggacggcaa atttggtttc tgccctagtg       840
     agagactcta cacggagcac ggcaacggag aaggcaaacc ctgtgtgttc ccgttcatct       900
     ttgagggccg ctcctactct gcctgcacca ctaaaggccg ctcggatggt taccgctggt       960
     gcgccaccac agccaactat gaccaggata aactgtatgg cttctgccct acccgagtgg      1020
     acgcgaccgt agttgggggc aactcggcag gagagctgtg cgtcttcccc ttcgtcttcc      1080
     tgggcaagca gtactcttcc tgtaccagcg acggccgcag ggatgggcgc ctctggtgtg      1140
     cgaccacatc gaacttcgac actgacaaga agtggggttt ctgtccagac caagggtaca      1200
     gcctgttcct ggtggcagcg cacgagttcg gccatgcact gggcttagat cattccagcg      1260
     tgccggaagc gctcatgtac ccgctgtata gctacctcga gggcttccct ctgaataaag      1320
     acgacataga cggcatccag tatctgtatg gtcgtggctc taagcctgac ccaaggcctc      1380
     cagccaccac cacaactgaa ccacagccga cagcacctcc cactatgtgt cccactatac      1440
     ctcccacggc ctatcccaca gtgggcccca cggttggccc tacaggcgcc ccctcacctg      1500
     gccccacaag cagcccgtca cctggcccta caggcgcccc ctcacctggc cctacagcgc      1560
     cccctactgc gggctcttct gaggcctcta cagagtcttt gagtccggca gacaatcctt      1620
     gcaatgtgga tgtttttgat gctattgctg agatccaggg cgctctgcat ttcttcaagg      1680
     acggttggta ctggaagttc ctgaatcata gaggaagccc attacagggc cccttcctta      1740
     ctgcccgcac gtggccagcc ctgcctgcaa cgctggactc cgcctttgag gatccgcaga      1800
     ccaagagggt tttcttcttc tctggacgtc aaatgtgggt gtacacaggc aagaccgtgc      1860
     tgggccccag gagtctggat aagttgggtc taggcccaga ggtaacccac gtcagcgggc      1920
     ttctcccgcg tcgtctcggg aaggctctgc tgttcagcaa ggggcgtgtc tggagattcg      1980
     acttgaagtc tcagaaggtg gatccccaga gcgtcattcg cgtggataag gagttctctg      2040
     gtgtgccctg gaactcacac gacatcttcc agtaccaaga caaagcctat ttctgccatg      2100
     gcaaattctt ctggcgtgtg agtttccaaa atgaggtgaa caaggtggac catgaggtga      2160
     accaggtgga cgacgtgggc tacgtgacct acgacctcct gcagtgccct tgaactaggg      2220
     ctccttcttt gcttcaaccg tgcagtgcaa gtctctagag accaccacca ccaccaccac      2280
     acacaaaccc catccgaggg aaaggtgcta gctggccagg tacagactgg tgatctcttc      2340
     tagagactgg gaaggagtgg aggcaggcag ggctctctct gcccaccgtc ctttcttgtt      2400
     ggactgtttc taataaacac ggatccccaa ccttttccag cc                         2442
//


spacer
spacer