spacer

EBI Dbfetch

ID   AK159177; SV 1; linear; mRNA; HTC; MUS; 2890 BP.
XX
AC   AK159177;
XX
DT   06-SEP-2005 (Rel. 85, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 11)
XX
DE   Mus musculus osteoclast-like cell cDNA, RIKEN full-length enriched library,
DE   clone:I420007G04 product:valosin containing protein, full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2890
RA   Arakawa T., Carninci P., Fukuda S., Hashizume W., Hayashida K., Hori F.,
RA   Iida J., Imamura K., Imotani K., Itoh M., Kanagawa S., Kawai J., Kojima M.,
RA   Konno H., Murata M., Nakamura M., Ninomiya N., Nishiyori H., Nomura K.,
RA   Ohno M., Sakazume N., Sano H., Sasaki D., Shibata K., Shiraki T.,
RA   Tagami M., Tagami Y., Waki K., Watahiki A., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (30-MAR-2004) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; 918c0d0e68a44a8f743f96cf10fcbfa1.
DR   Ensembl-Gn; ENSMUSG00000028452; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000030164; mus_musculus.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Tissues were provided by Takashi Ishikawa  ( Department of Surgery
CC   2 Yokohama City University 3-9 Fukuura,Kanazawa-ku,Yokohama
CC   236-0004 Japan ) whose assistance we gratefully acknowledge.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=I420007G04
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2890
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="I420007G04"
FT                   /cell_type="osteoclast-like cell"
FT                   /db_xref="taxon:10090"
FT   CDS             259..2679
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="putative"
FT                   /note="valosin containing protein (MGD|MGI:99919
FT                   GB|NM_009503, evidence: BLASTN, 99%, match=2888)"
FT                   /db_xref="GOA:Q01853"
FT                   /db_xref="InterPro:IPR003338"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR004201"
FT                   /db_xref="InterPro:IPR005938"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR015415"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029067"
FT                   /db_xref="MGI:MGI:99919"
FT                   /db_xref="PDB:1E32"
FT                   /db_xref="PDB:1R7R"
FT                   /db_xref="PDB:1S3S"
FT                   /db_xref="PDB:2PJH"
FT                   /db_xref="PDB:3CF0"
FT                   /db_xref="PDB:3CF1"
FT                   /db_xref="PDB:3CF2"
FT                   /db_xref="PDB:3CF3"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q01853"
FT                   /protein_id="BAE34876.1"
FT                   /translation="MASGADSKGDDLSTAILKQKNRPNRLIVDEAINEDNSVVSLSQPK
FT                   MDELQLFRGDTVLLKGKKRREAVCIVLSDDTCSDEKIRMNRVVRNNLRVRLGDVISIQP
FT                   CPDVKYGKRIHVLPIDDTVEGITGNLFEVYLKPYFLEAYRPIRKGDIFLVRGGMRAVEF
FT                   KVVETDPSPYCIVAPDTVIHCEGEPIKREDEEESLNEVGYDDIGGCRKQLAQIKEMVEL
FT                   PLRHPALFKAIGVKPPRGILLYGPPGTGKTLIARAVANETGAFFFLINGPEIMSKLAGE
FT                   SESNLRKAFEEAEKNAPAIIFIDELDAIAPKREKTHGEVERRIVSQLLTLMDGLKQRAH
FT                   VIVMAATNRPNSIDPALRRFGRFDREVDIGIPDATGRLEILQIHTKNMKLADDVDLEQV
FT                   ANETHGHVGADLAALCSEAALQAIRKKMDLIDLEDETIDAEVMNSLAVTMDDFRWALSQ
FT                   SNPSALRETVVEVPQVTWEDIGGLEDVKRELQELVQYPVEHPDKFLKFGMTPSKGVLFY
FT                   GPPGCGKTLLAKAIANECQANFISIKGPELLTMWFGESEANVREIFDKARQAAPCVLFF
FT                   DELDSIAKARGGNIGDGGGAADRVINQILTEMDGMSTKKNVFIIGATSRPDIIDPAILR
FT                   PGRLDQLIYIPLPDEKSRVAILKANLRKSPVAKDVDLEFLAKMTNGFSGADLTEICQRA
FT                   CKLAIRESIESEIRRERERQTNPSAMEVEEDDPVPEIRRDHFEEAMRFARRSVSDNDIR
FT                   KYEMFAQTLQQSRGFGSFRFPSGNQGGAGPSQGSGGGTGGSVYTEDNDDDLYG"
FT   polyA_signal    2868..2873
FT                   /note="putative"
FT   polyA_site      2890
FT                   /note="putative"
XX
SQ   Sequence 2890 BP; 730 A; 665 C; 800 G; 695 T; 0 other;
     gcagtctccg tgaagcgttt gcagccgtcg tttgattagt cgctgccccc ctcgcggatt        60
     aggagctagc gtctcccgcc cgcccgcctg ccgccccggt gcccctggga ggaagcgaga       120
     gggaggctgc cagagggttt gtcactgctg ttgctcctcc gcctcagcga gtccagcccc       180
     ggcctagtcg gtcgcctgcc tttctcatag ccgttaccct caggccgcca cagccgccga       240
     ccgggagagg cgcgcgccat ggcctctgga gccgattcaa aaggtgatga tttatcaaca       300
     gccattctca aacagaagaa ccgacccaat cggttaattg ttgatgaagc catcaatgaa       360
     gataacagcg tggtgtcctt gtcccagccc aagatggatg aactgcagtt gttccgaggt       420
     gacacggtgt tgctaaaagg aaagaaaaga cgggaagctg tatgcattgt tctttctgat       480
     gacacgtgtt ctgatgagaa gattcgaatg aatagagttg ttcggaataa cctccgagtt       540
     cgcctaggag atgtcatcag catccagcca tgccctgatg taaagtatgg caaacgtatc       600
     cacgttctac ccatcgatga cacagtggaa ggcatcactg gcaatctctt tgaggtatac       660
     cttaagccgt acttcctgga agcttatcgg cccatccgta aaggagatat ttttcttgtc       720
     cggggtggga tgcgtgctgt ggagttcaaa gttgtagaga cagatcccag cccttactgt       780
     attgttgctc cagacacagt gatccactgt gagggggagc caatcaagcg agaggatgag       840
     gaggaatcct tgaatgaagt aggctatgat gacatcggtg gttgcaggaa gcagctagct       900
     cagataaagg agatggtgga gctgccactg agacatcctg cgctctttaa ggcgattggt       960
     gtaaagcctc ctcggggaat cttgttgtat gggcctcctg ggacagggaa gaccctgatt      1020
     gctcgagctg tggcaaatga aactggagcc ttcttctttc tgatcaatgg tcctgaaatc      1080
     atgagcaaat tggctggtga gtctgagagc aaccttcgta aagcctttga ggaagctgaa      1140
     aagaatgctc ctgctatcat cttcatcgat gagcttgatg ccattgcacc caaaagagag      1200
     aaaactcatg gggaagtgga gcgtcgcatc gtgtctcagt tgttgaccct catggatggc      1260
     ctaaagcaga gagcacatgt gatagttatg gcagcaacca atagacccaa cagcattgac      1320
     ccagccctac ggcgatttgg tcgctttgac agagaggtag atattggaat acctgatgct      1380
     acaggacgtt tggagattct tcagatccat accaagaaca tgaaactggc agatgatgtg      1440
     gacttggaac aggtagccaa tgagactcat ggtcatgttg gtgctgattt ggcagcccta      1500
     tgttcagagg ctgctctgca ggccatccgg aaaaaaatgg acctcattga cctagaagat      1560
     gagaccattg atgctgaggt catgaattcc ctggcagtta ctatggatga cttccggtgg      1620
     gctttgagtc aaagcaaccc atcagcactt cgggaaactg tggtagaggt gccacaagta      1680
     acctgggaag atattggagg cctggaggat gtcaaacgtg agcttcagga gttggttcag      1740
     tatcctgtgg aacatccaga caaattcctc aaatttggca tgactccctc caaaggcgtt      1800
     cttttctatg gacctcctgg ctgtgggaaa accttactgg ctaaagccat tgctaatgaa      1860
     tgccaggcca acttcatctc catcaagggt cctgagctgc ttaccatgtg gtttggggaa      1920
     tctgaggcca atgtccggga aatttttgac aaggcacggc aagctgcccc ctgtgtactc      1980
     ttctttgatg agttagattc aattgccaag gctcgaggtg gtaatattgg agatggtggt      2040
     ggagctgctg accgagtcat caatcagatc ctgacagaaa tggatggcat gtctacaaaa      2100
     aagaatgtgt ttatcattgg agctaccagc aggcctgaca tcattgatcc tgctatccta      2160
     agacctggcc gtctagatca gctcatttat atcccacttc ctgatgagaa gtcccgtgtt      2220
     gccatcctaa aagccaatct gcgaaagtcc ccagttgcca aggatgtgga tttggagttc      2280
     ctggctaaga tgactaatgg cttttctgga gctgatttga cagaaatttg ccaacgggct      2340
     tgtaaactgg ccattcgtga atctattgag agtgagatta ggcgagaacg agagaggcag      2400
     acaaatccat cggctatgga ggtagaagag gacgatccag tgcctgagat ccgcagagat      2460
     cactttgagg aagccatgcg ttttgcccga cgttctgtca gcgataatga cattcggaag      2520
     tatgaaatgt tcgcccagac actgcagcag agtcgaggtt ttggcagctt cagattccct      2580
     tcagggaacc agggtggagc tggtcccagc cagggcagtg gaggtggcac aggtggcagt      2640
     gtgtacacag aagacaatga cgatgacctg tatggctaag tgatgtgcca gcatgcagcg      2700
     agctggcctg gctggacctt gttccctggg ggagggggcg cttgcccaag agggaccagg      2760
     ggtgtgccca tggcctgttc cattcctcag tctgaacagt tcagccccag tcagactctg      2820
     gacaggggtt tcctgttgca aaaaaaaaaa aattacaaaa gcgataaaat aaaagtgatt      2880
     ttcatttggg                                                             2890
//


spacer
spacer