Dbfetch

ID   AK159064; SV 1; linear; mRNA; HTC; MUS; 2911 BP.
XX
AC   AK159064;
XX
DT   06-SEP-2005 (Rel. 85, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 11)
XX
DE   Mus musculus visual cortex cDNA, RIKEN full-length enriched library,
DE   clone:K530047N18 product:Brain specific Na+-dependent inorganic phosphate
DE   cotransporter homolog [Rattus norvegicus], full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2911
RA   Arakawa T., Carninci P., Fukuda S., Hashizume W., Hayashida K., Hori F.,
RA   Iida J., Imamura K., Imotani K., Itoh M., Kanagawa S., Kawai J., Kojima M.,
RA   Konno H., Murata M., Nakamura M., Ninomiya N., Nishiyori H., Nomura K.,
RA   Ohno M., Sakazume N., Sano H., Sasaki D., Shibata K., Shiraki T.,
RA   Tagami M., Tagami Y., Waki K., Watahiki A., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (30-MAR-2004) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science, e1252229 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science, e1252229 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; d014ee052b380f5d128b6b9f6266c9b3.
DR   Ensembl-Gn; ENSMUSG00000070570; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0032205; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0032184; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0032120; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0032196; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0031912; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0032688; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0031240; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0031876; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0032034; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0031985; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0032112; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0032022; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0032704; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0030963; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0031357; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000085374; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0083735; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0083804; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0083749; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0083776; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0083350; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0084272; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0083861; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0083287; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0083475; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0083328; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0083491; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0083380; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0084548; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0083280; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0082402; mus_musculus_wsbeij.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Tissues were provided by Michela Fagiolini and Takao K. Hensch (
CC   Laboratory for Neuronal Circuit Development Brain Science
CC   Institute RIKEN 2-1 Hirosawa,Wako-shi,Saitama 351-0198 Japan )
CC   whose assistance we gratefully acknowledge.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=K530047N18
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2911
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="K530047N18"
FT                   /tissue_type="visual cortex"
FT                   /db_xref="taxon:10090"
FT   CDS             136..1818
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="Brain specific Na+-dependent inorganic phosphate
FT                   cotransporter homolog [Rattus norvegicus] (UniProt|Q62634,
FT                   evidence: FASTY, 99.6%ID, 100%length, match=1680)"
FT                   /note="putative"
FT                   /db_xref="GOA:Q3TXX4"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="MGI:MGI:1920211"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3TXX4"
FT                   /protein_id="BAE34790.1"
FT                   /translation="MEFRQEEFRKLAGRALGRLHRLLEKRQEGAETLELSADGRPVTTH
FT                   TRDPPVVDCTCFGLPRRYIIAIMSGLGFCISFGIRCNLGVAIVSMVNNSTTHRGGHVVV
FT                   QKAQFNWDPETVGLIHGSFFWGYIVTQIPGGFICQKFAANRVFGFAIVATSTLNMLIPS
FT                   AARVHYGCVIFVRILQGLVEGVTYPACHGIWSKWAPPLERSRLATTAFCGSYAGAVVAM
FT                   PLAGVLVQYSGWSSVFYVYGSFGIFWYLFWLLVSYESPALHPSISEEERKYIEDAIGES
FT                   AKLMNPVTKFNTPWRRFFTSMPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFEISKV
FT                   GLVSALPHLVMTIIVPIGGQIADFLRSRHIMSTTNVRKLMNCGGFGMEATLLLVVGYSH
FT                   SKGVAISFLVLAVGFSGFAISGFNVNHLDIAPRYASILMGISNGVGTLSGMVCPIIVGA
FT                   MTKHKTREEWQYVFLIASLVHYGGVIFYGVFASGEKQPWAEQEEMSEEKCGFVGHDQLA
FT                   GSDESEMEDEAEPPGAPPAPPPSYGATHSTVQPPRPPPPVRDY"
FT   regulatory      2892..2897
FT                   /note="putative"
FT                   /regulatory_class="polyA_signal_sequence"
FT   polyA_site      2911
FT                   /note="putative"
XX
SQ   Sequence 2911 BP; 514 A; 884 C; 820 G; 693 T; 0 other;
     gactcgcagc ctggttcccc cccgagcgga gctgcggggc cgggccgggc cggggcggac        60
     cccgggatcc cggacgcggc cgcccgggcc cgcgggcggg gggattggca ggggacccgc       120
     gtgggcacag ccaccatgga gttccggcag gaggagtttc ggaagctggc ggggcgcgcc       180
     ctggggaggc tgcaccggtt actggagaag cggcaggaag gcgcggagac actggagctg       240
     agtgccgacg ggcggccagt gaccacgcac actcgggacc cgcctgtggt ggactgcacc       300
     tgctttggcc tccctcgtcg ctacatcatc gccatcatga gcggtctggg tttctgtatc       360
     agctttggca tccgctgcaa cctgggcgtg gccatcgtgt ccatggtcaa caacagcaca       420
     acccaccgtg ggggccacgt ggtggtgcag aaagcccagt tcaactggga tccagagact       480
     gtcggcctca tacatggctc ctttttctgg ggctacattg tcactcagat tcctggagga       540
     tttatctgcc aaaaattcgc agccaacagg gtctttggct ttgccattgt ggctacctcc       600
     accctaaaca tgttgatccc ttcagcagcc cgcgttcact atggctgtgt catcttcgtg       660
     aggatccttc agggattggt ggagggggtc acataccctg cttgccatgg catctggagc       720
     aaatgggccc ctcccttaga acggagtcgg ctggcaacga cagccttttg cggttcctat       780
     gctggggcgg tggttgccat gcccttggct ggggtccttg tgcagtattc aggatggagt       840
     tctgtcttct atgtctatgg cagcttcggg atcttttggt acctgttctg gttgcttgtc       900
     tcctatgagt caccggcact gcaccccagc atctctgagg aggagcgcaa atacattgag       960
     gatgccatcg gggagagcgc caagctcatg aaccctgtta cgaagtttaa cacaccctgg      1020
     aggcgcttct ttacgtccat gcccgtctat gccatcatcg ttgcgaactt ttgccgcagc      1080
     tggaccttct acctgctcct catctctcag cccgcctact ttgaagaagt gttcggcttt      1140
     gagatcagca aggtggggct ggtgtcggcg ctgcctcacc ttgtcatgac catcatcgta      1200
     cccattggag gccagatcgc tgactttttg cgcagtcgtc acataatgtc cactaccaac      1260
     gtgcgaaagc tcatgaactg cgggggtttc gggatggaag ccacgctgct gctggtggtc      1320
     ggatactcgc actccaaggg cgtggccatc tccttcctgg tcctggctgt gggcttcagt      1380
     ggctttgcca tctctgggtt taacgtgaac cacttggaca tcgcccctcg ctatgccagc      1440
     atcttgatgg gcatttccaa tggcgtgggc acactgtctg ggatggtgtg ccccatcatc      1500
     gtgggtgcaa tgaccaagca caagacgcgg gaggagtggc agtacgtgtt cctcatagcc      1560
     tccctggtgc actacggcgg tgtcatcttc tatggggtct ttgcttcggg agagaagcag      1620
     ccgtgggcag agcaggagga gatgagcgag gagaagtgtg gctttgttgg ccacgaccag      1680
     ctggctggca gtgacgaaag tgaaatggag gacgaggctg agcccccagg ggcgcccccc      1740
     gcgccgcctc cgtcctacgg ggccacacac agcacagtgc agcctccgag gcccccgccc      1800
     cctgtccggg actactgacc acgggcctcc cactgtgggg cagtttccag gacttccact      1860
     ccatacacct ctagcctgag cggcagtgtc gaggaacccc actcctcccc tgcctcaggc      1920
     ttaagatgca agtcctccct tgttcccagt gctgtccgac cagccctctt tccctctcaa      1980
     ctgcctcctg cggggggtga agctgcacac tagcagtttc aaggataccc agactcccct      2040
     gaaagtcgtt ctccgcttgt ttctgcctgt gtgggctcaa atctcccctt tgagggcttt      2100
     atttggaggg acagttcaac ctcttcctct cttgtggttt tgaggtttca ccccttcccc      2160
     caagacccca gggattctca ggctaccccg agattattca ggtggtcccc tactcagaag      2220
     acttcatggt cgtcctctat tagtttcaag gctcgcctaa ccaattctac atttttccaa      2280
     gctggtttaa cctaaccacc aatgccgccg ttcccaggac tgattctcac cagcgtttct      2340
     gagggaaaat ggcggtttca agtcccccca cccccctttt cttccctcgt cccctcacca      2400
     gcacactttg ccgggccttg accttagctt agtacaatca ttgtccaggg aaatggccaa      2460
     aatggctctg ctcaccccgt gctctttttc tgactcagtt ttcaggtctc agtagtggct      2520
     gcccaaagct attaattcag cggctcgagg ccacctcttc ctccccgtgg tggtttcagg      2580
     atccccctcg cccccccccc cccaaatcct tgcactttat tctcctgggt ggttccaggc      2640
     cgccctcggt ttctcagtgg ccatttgttg tgtgtccctc aggggctaaa tgattccaaa      2700
     tctggggtgc ttcccctcat agacacccct ctctcaacgt agaaatctgg gtgggggtga      2760
     ggtgtgtgag agaagttaca gaatcccagg aaagggagcg gggctgggag gagagggttg      2820
     ttcctggggc agggtcgtgt cttggtgtct gtctctgtga cgtaaatcct gccctgcccc      2880
     accccactcc caataaacgc tctggtgtac g                                     2911
//