spacer

EBI Dbfetch

ID   AK158963; SV 1; linear; mRNA; HTC; MUS; 3420 BP.
XX
AC   AK158963;
XX
DT   06-SEP-2005 (Rel. 85, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 10)
XX
DE   Mus musculus visual cortex cDNA, RIKEN full-length enriched library,
DE   clone:K530020K16 product:guanine nucleotide binding protein (G protein),
DE   gamma 7 subunit, full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-3420
RA   Arakawa T., Carninci P., Fukuda S., Hashizume W., Hayashida K., Hori F.,
RA   Iida J., Imamura K., Imotani K., Itoh M., Kanagawa S., Kawai J., Kojima M.,
RA   Konno H., Murata M., Nakamura M., Ninomiya N., Nishiyori H., Nomura K.,
RA   Ohno M., Sakazume N., Sano H., Sasaki D., Shibata K., Shiraki T.,
RA   Tagami M., Tagami Y., Waki K., Watahiki A., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (30-MAR-2004) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; 95aee9c6beacb40918b6956fcf35454e.
DR   Ensembl-Gn; ENSMUSG00000048240; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000092285; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000099462; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000117805; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000118233; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000118465; mus_musculus.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Tissues were provided by Michela Fagiolini and Takao K. Hensch (
CC   Laboratory for Neuronal Circuit Development Brain Science
CC   Institute RIKEN 2-1 Hirosawa,Wako-shi,Saitama 351-0198 Japan )
CC   whose assistance we gratefully acknowledge.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=K530020K16
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3420
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="K530020K16"
FT                   /tissue_type="visual cortex"
FT                   /db_xref="taxon:10090"
FT   CDS             222..428
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="guanine nucleotide binding protein (G protein),
FT                   gamma 7 subunit (MGD|MGI:95787 GB|NM_010319, evidence:
FT                   BLASTN, 99%, match=3284)"
FT                   /note="putative"
FT                   /db_xref="GOA:Q3UGN1"
FT                   /db_xref="InterPro:IPR001770"
FT                   /db_xref="InterPro:IPR015898"
FT                   /db_xref="MGI:MGI:95787"
FT                   /db_xref="UniProtKB/TrEMBL:Q3UGN1"
FT                   /protein_id="BAE34744.1"
FT                   /translation="MSGTNNVAQARKLVEQLRIEAGIERIKVSKASSDLMGYCEQHARN
FT                   DPLLVGVPASENPFKDKKPCIIL"
FT   polyA_signal    3402..3407
FT                   /note="putative"
FT   polyA_site      3420
FT                   /note="putative"
XX
SQ   Sequence 3420 BP; 770 A; 991 C; 878 G; 781 T; 0 other;
     gctttgctat atcgagcctg caggagagcg gtgcctgagc cacgtgccca tgtcagcgtg        60
     ggaagggaag ggggctcaga cagcccatcc cacccactcg ctccctgcgg aggagctgcg       120
     acctgctgga gagggtgtga agcctttcta ttggaacctc agtgctggga cggtgggacg       180
     gtgcagctct ctagacgcca ggtccacgct catggccgat gatgtcaggt actaacaacg       240
     tcgcccaggc ccggaagctg gtggagcagc tgcgcattga agctgggatc gaacgcatca       300
     aggtctccaa ggcctcgtca gacctgatgg gctactgtga gcaacatgcc cgcaacgatc       360
     ccttgctggt tggcgtgcca gcctctgaga atccattcaa agacaaaaag ccttgcataa       420
     ttctctagtt ctctctcttt ctctctctct tccccatctc tccctctctt tctccccacc       480
     ccggaggtat tggtccaatt tttcctgtaa ggaaaatatt tgaatccttc ccactttgaa       540
     ttctaaagga acaaaaacca ttgtgaatgc cgggatcttc ctgacctagc tggagtttat       600
     gaacccaggt ggggctctga ctgtcgcctg gcctaactga gatgttagcc tcgtcacccc       660
     caccccctct tttcaagagt cactactgtg gcccattttt aaagctcccc ttagttgcct       720
     tggggaaagg gctccgttga taaacgggat tgccttgcaa gcgtgaggac cctaggtgcg       780
     gcgcggtcct caggtcccac agaaagcatg caggtgcagt gtcacaaggt tgtatgtact       840
     tcagcacttg gtaggcaagg cagaagggtc cccagggctt gagggactgc cattctagtt       900
     gtcagtaaac tccagacaga ggaggacacc cagccttgac ctctggctcc acccgcgcgg       960
     ggcacacaca atgcaccctg tgctgccctg tgtccttcca gagtggccct gtcatgtaca      1020
     cagtgacgcc atttctccag agacatggcc cattccagag acgggcatct gggtctccat      1080
     tcaaaggaag ctcttgctgg tatgaccgag tgtgtaattt tgtctcctaa gcctgagatc      1140
     cacgtggtca ttggtggctc cccattttct cccagttaca cagttatcca ggtagttgtg      1200
     agggcagaaa tgcagattag ttatctctcg aggtgatcga ggagtgacgg ggttctccgt      1260
     cccacatcgt gactgtggct ccagatcccc ctgcctcctt cctaggacaa actattttgt      1320
     aactagctag aatccaagcc cctcagtgtg gggactgtag ccctggtctg cactcccaga      1380
     ttgggggatt ctaggcaggg ctccacccag accacacccc aatgaggatt tggggactct      1440
     aggcggggct ccaccccgaa ctgcgacctc agccccttac tggggcattc taggtggggc      1500
     tctacattga ccactccccc agcccctcac tgggagattg tagtctgggg ctccaccctg      1560
     accacgcccc tagacccttg ttggtagatt ctccacagca ttctacccct gagccaggcc      1620
     tcttctcttt ctattttgtg aacagagccc tagagtccag gctggcctgg aacaggagat      1680
     cttcctgcct ctgtctccag agtacctaca tgacggtctt gtgcttgcat gcctggcatt      1740
     ggattggact gaagaaaaca tgccctctgt ctgtaacagt gacagtggca ggtataggga      1800
     ggacacgact tgggtgtgcc aatgcggtgt gcagccacac acagaggcag cctaagcatt      1860
     tgaaagaccc cagctgcctc tttctcctgc cagatcagta tgggagcaaa ccgcagaact      1920
     gaagccagtc tagttgttcc ctgtatccct ggtggaaatc tgctgccaaa agcctgggcc      1980
     aggctgatcc ctgggcaaag tgaaaggggt gagcacagtt agctcatctt ctagccagtt      2040
     aggcatgacc taccgcctag gtaaggtggc aggctccccc aaatccattt gatggaaaca      2100
     ggaaaagaag tctggggtgt gactaagggg aggcattgca ggtgctaaga gcgcccccct      2160
     cccacttccc cctccatggg ctgggtccca gagagcacag accaagggtc tggcttctgt      2220
     gcatcagctc ccattactgg tcagagaggg ccagcaactt tggtcagcct gactctcaga      2280
     acctggcttg agtcagaaaa gccagtttcc cccaccctca aactacagcc accttgcatt      2340
     aggctaggaa ccaggtccca ggatgtgtgt ccccagctac actggcaagg agaaaggaaa      2400
     gctggaaatc tggggaccag ggctgcagag cacccaccca gcatgctgga aagctgggtt      2460
     ccaccccaag ctcgaagtaa ccaggcacgg gcactggggt aggcagatca ggacttcagg      2520
     gtcttcctca gctacataat gggctcaggg ctaacctgga ctacatgaga ccatgtctca      2580
     aattcagtgc actctctcac tctctcacat cacgacagca gatgcctgcc tggccagcct      2640
     gtgtgtggtc ggagcatttt gtttctctcc tctgggacaa aaaactcaaa tctgcatctc      2700
     tgcccacact tccagttctc cctccctagg tgactcacag gccaaggaca aagtgacttc      2760
     ttgttcccaa ggaaggtagg acgtgcttgg ctgatgtatc caggatggac cttgggcccc      2820
     aatagccctt gtgtgccctc ctaaccactg gagccctgcc tcagcttaga gatacttagg      2880
     gaaaccagaa cacaacagag ccatcaggag ccaagattgg gggccctcac cttcaatccc      2940
     aacacttggg agacagaggc aaggggatct ccgtgaattc gaggccagcc tcatctacgg      3000
     agtgagttcc aggacagcca gggttgtaga gacaccgtct aaaaacaaaa taaaacaacc      3060
     aaaactgtta gacctgctgc agcttgagcc acccaggagg gacttccaac ctaaggagaa      3120
     ggttggtggg catggggggg tgtatcctac acagaagcca tatacactgg ccagatgtca      3180
     catggcactt tccatttccg tccccacttc agggctggct cctccccctc acgctccagg      3240
     gctggctcct accccttcag actcctcccc cttccctctg ctttgtgaag ctggttggtt      3300
     tttatttctg attaaaaaaa aaactttttc ccgtgtgcca cgcccactct cccagtgtta      3360
     ctattgtgtg gaatgaggtc acaggagagt gactcctcca taataaaagc ctcgattttc      3420
//


spacer
spacer