spacer

EBI Dbfetch

ID   AK158939; SV 1; linear; mRNA; HTC; MUS; 2092 BP.
XX
AC   AK158939;
XX
DT   06-SEP-2005 (Rel. 85, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 11)
XX
DE   Mus musculus visual cortex cDNA, RIKEN full-length enriched library,
DE   clone:K530014D01 product:glutathione S-transferase, theta 2, full insert
DE   sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2092
RA   Arakawa T., Carninci P., Fukuda S., Hashizume W., Hayashida K., Hori F.,
RA   Iida J., Imamura K., Imotani K., Itoh M., Kanagawa S., Kawai J., Kojima M.,
RA   Konno H., Murata M., Nakamura M., Ninomiya N., Nishiyori H., Nomura K.,
RA   Ohno M., Sakazume N., Sano H., Sasaki D., Shibata K., Shiraki T.,
RA   Tagami M., Tagami Y., Waki K., Watahiki A., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (30-MAR-2004) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; d2e97b6d4ea7c168816482079878dad3.
DR   Ensembl-Gn; ENSMUSG00000033318; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000038257; mus_musculus.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Tissues were provided by Michela Fagiolini and Takao K. Hensch (
CC   Laboratory for Neuronal Circuit Development Brain Science
CC   Institute RIKEN 2-1 Hirosawa,Wako-shi,Saitama 351-0198 Japan )
CC   whose assistance we gratefully acknowledge.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=K530014D01
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2092
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="K530014D01"
FT                   /tissue_type="visual cortex"
FT                   /db_xref="taxon:10090"
FT   CDS             587..1321
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="glutathione S-transferase, theta 2 (MGD|MGI:106188
FT                   GB|BC012707, evidence: BLASTN, 99%, match=912)"
FT                   /note="putative"
FT                   /db_xref="GOA:Q61133"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="MGI:MGI:106188"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q61133"
FT                   /protein_id="BAE34734.1"
FT                   /translation="MGLELYLDLLSQPSRAVYIFAKKNGIPFQTRTVDILKGQHMSEQF
FT                   SQVNCLNKVPVLKDGSFVLTESTAILIYLSSKYQVADHWYPADLQARAQVHEYLGWHAD
FT                   NIRGTFGVLLWTKVLGPLIGVQVPQEKVERNRDRMVLVLQQLEDKFLRDRAFLVGQQVT
FT                   LADLMSLEELMQPVALGYNLFEGRPQLTAWRERVEAFLGAELCQEAHSTILSILGQAAK
FT                   KMLPVPPPEVHASMQLRIARIP"
XX
SQ   Sequence 2092 BP; 498 A; 525 C; 525 G; 544 T; 0 other;
     gggagagtgt tggaggcggg cgagagaggt ggtcctgtga ctccttcaag ctttgctgcc        60
     cagcctcaca gatctgggga ggtccagtgt tcttagacga cctgttttgc acggggcagc       120
     tggaccaacc acagttcttc cttaaggcaa agtttctagc agcctgcaac aagcttcacc       180
     cgttaaagaa ggatcagcga tcagcctcta agatcccctc ctgcagtaac tgagagctag       240
     gagctgagcg gtctagttcc ccgcaaacga ctacgtccac agaactctga gttgggtcca       300
     cgaaagccca gctaggccat ttccgcgtcc gggtgagact aaggtcctgg gctggattcc       360
     tggctccacg gtccgctgga gcaaatcgca taagtcagtc tgagtgcgcg cgcacctcag       420
     ccctgctttt ggtataaagt cctccaaagc gtctccctcc ccaagatcag caggtgtcag       480
     ctatccagag gaggaaatcg tttggcttgg ccaactgagg ctgtgctgga ccccagcttg       540
     ctgttatcga acgcagtcgg cacaccatct tgtgtcgcta ccggcaatgg gcttggagct       600
     ctacctggac ctgctgtcac aacccagccg cgctgtctac atcttcgcca agaagaatgg       660
     catccccttc cagacgcgta ccgtggatat actcaaaggg cagcacatga gcgagcaatt       720
     ctcccaggtg aactgcttaa acaaagttcc tgtactcaaa gacggaagct tcgtgttgac       780
     cgaaagcaca gccatcttga tttacctgag ttccaagtac caggtggcag accactggta       840
     cccggccgac ctacaggccc gtgcccaagt ccacgaatac ctgggctggc atgccgacaa       900
     catccgtggt actttcggag tgctcctatg gaccaaggtg ttggggccac tcattggggt       960
     ccaggttccc caggagaagg tggaacggaa cagagataga atggtcctgg ttctgcaaca      1020
     gctggaggac aagttcctca gggacagggc cttccttgtt ggccagcagg tgacgctagc      1080
     ggatctcatg tctctggagg agttgatgca gcccgtggct cttggctata acctgtttga      1140
     gggacggcct cagctgacag catggcgaga gagggtggag gcgttcttgg gtgctgagct      1200
     gtgtcaggag gctcatagca ccatcctgag catcctggga caggcagcca agaaaatgtt      1260
     accagtaccc cctccggagg tccatgccag catgcagctt cgaattgcta ggattccttg      1320
     agtggtctga ccagcaataa agactcattt tgtgtttttt ctttcctttt ttttcttttt      1380
     tttaaaaaat atttatttat ttgtttgttg tatgtgggtg cactgtagct gtcttcagac      1440
     tctcattgcg ggtggttgtg ggccacagtg tggttgctgg gatttgagct tcggaccttt      1500
     ggaggagcgg tcgggtgctc ttgcccgctg agacatctca ccaacccctt tccttttttt      1560
     tcttaacgtt tctttttgcc ccagtctttt atcctggctc cctctctgac tctgagagaa      1620
     gctttaaaag gaacaccagc tatccttagc atgcttctct taaggtacag tatacacaac      1680
     ctataggaga cccaaatcaa taatatataa aagatgcttt aaaaaaaaaa aaacagtaac      1740
     acacccaaag aaaccaatca aaagttggta gacatctgtg ttttattata ataaagagtc      1800
     tgaatagttt aaggaataaa gagctattgg tttttttgtt tgttttgaga cagggtttct      1860
     ctggctgtcc tggaactcac tttgtagatc atgctgtcct cgggctcaga aatccacctg      1920
     cctctgcctc ccgagtgctg ggactaaagg tgtgcgccac cacgcccagc tcgttaattg      1980
     gttttattat actgtcctat aatatgcatg gaatcaaatt atgactccgt gaaacattat      2040
     ggttaatcat agaaaagtca cataacaatc cacataaaat tattacacgg gc              2092
//


spacer
spacer