Dbfetch

ID   AK158917; SV 1; linear; mRNA; HTC; MUS; 2105 BP.
XX
AC   AK158917;
XX
DT   06-SEP-2005 (Rel. 85, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 11)
XX
DE   Mus musculus visual cortex cDNA, RIKEN full-length enriched library,
DE   clone:K530006I19 product:G-protein coupled receptor 3, full insert
DE   sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2105
RA   Arakawa T., Carninci P., Fukuda S., Hashizume W., Hayashida K., Hori F.,
RA   Iida J., Imamura K., Imotani K., Itoh M., Kanagawa S., Kawai J., Kojima M.,
RA   Konno H., Murata M., Nakamura M., Ninomiya N., Nishiyori H., Nomura K.,
RA   Ohno M., Sakazume N., Sano H., Sasaki D., Shibata K., Shiraki T.,
RA   Tagami M., Tagami Y., Waki K., Watahiki A., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (30-MAR-2004) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science, e1252229 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science, e1252229 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; c761c0066325d990517d1a4a0d8327c9.
DR   Ensembl-Gn; ENSMUSG00000049649; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000052090; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000105911; mus_musculus.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Tissues were provided by Michela Fagiolini and Takao K. Hensch (
CC   Laboratory for Neuronal Circuit Development Brain Science
CC   Institute RIKEN 2-1 Hirosawa,Wako-shi,Saitama 351-0198 Japan )
CC   whose assistance we gratefully acknowledge.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=K530006I19
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2105
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="K530006I19"
FT                   /tissue_type="visual cortex"
FT                   /db_xref="taxon:10090"
FT   CDS             87..1079
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="G-protein coupled receptor 3 (MGD|MGI:101908
FT                   GB|NM_008154, evidence: BLASTN, 99%, match=2000)"
FT                   /note="putative"
FT                   /db_xref="GOA:P35413"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000723"
FT                   /db_xref="InterPro:IPR000984"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:101908"
FT                   /db_xref="UniProtKB/Swiss-Prot:P35413"
FT                   /protein_id="BAE34727.1"
FT                   /translation="MMWGAGSSMAWFSAGSGSVNVSSVDPVEEPTGPATLLPSPRAWDV
FT                   VLCISGTLVSCENALVVAIIVGTPAFRAPMFLLVGSLAVADLLAGLGLVLHFAADFCIG
FT                   SPEMSLMLVGVLAMAFTASIGSLLAITVDRYLSLYNALTYYSETTVTRTYVMLALVWVG
FT                   ALGLGLVPVLAWNCRDGLTTCGVVYPLSKNHLVVLAIAFFMVFGIMLQLYAQICRIVCR
FT                   HAQQIALQRHLLPASHYVATRKGIATLAVVLGAFAACWLPFTVYCLLGDADSPRLYTYL
FT                   TLLPATYNSMINPVIYAFRNQDVQKVLWAICCCCSTSKIPFRSRSPSDV"
FT   regulatory      2081..2086
FT                   /note="putative"
FT                   /regulatory_class="polyA_signal_sequence"
FT   polyA_site      2105
FT                   /note="putative"
XX
SQ   Sequence 2105 BP; 412 A; 615 C; 540 G; 538 T; 0 other;
     gggggtccgc gcacaccttg ctctgccaga acctgagtgg aggcgccccg cggcccggcc        60
     gcacccggtc ctgagccacc ggtaccatga tgtggggagc aggaagctct atggcctggt       120
     tctcagctgg ctcaggcagt gtgaacgtga gcagcgtgga cccagtagag gaacccacag       180
     gcccagctac actgctgccc tctcccaggg cctgggatgt ggtgctgtgc atctcaggca       240
     ccctggtgtc ctgcgagaac gcgctggtgg tggccatcat tgtgggcact cctgccttcc       300
     gcgcccccat gttcctgctg gtgggtagct tggccgtagc agacctgctg gcaggcctgg       360
     gcctggtcct gcactttgcg gctgacttct gcattggctc accagagatg agcttgatgc       420
     tggtcggcgt gctagcaatg gccttcactg ccagcatcgg cagcctgctg gccattaccg       480
     ttgaccgcta cctttccctg tacaatgctc tcacttacta ctcagagaca acggtaactc       540
     ggacttatgt gatgctggcc ttggtgtggg tgggtgccct gggcctgggg ctggttcccg       600
     tgctggcctg gaactgccgg gatggcctga ccacgtgtgg tgtggtctat ccactctcca       660
     agaaccatct ggtggttctg gccatcgcct tcttcatggt gtttggcatc atgttgcagc       720
     tctatgccca gatctgccgc atcgtctgcc gccatgccca gcagatcgcc ctccaacgac       780
     acctgctgcc tgcctctcac tacgtggcca cccgcaaggg catcgccaca ttggctgtgg       840
     tgcttggcgc ctttgctgcc tgttggttgc ccttcactgt ctactgcctc ctgggagatg       900
     ccgactctcc ccgtctctac acctatctta ccctgctccc agccacctac aactccatga       960
     tcaaccctgt catctacgcc tttcgcaacc aagatgtgca gaaggtgctg tgggccatct      1020
     gctgctgctg ttccacttcc aagattccat tccggtcccg gtcccctagt gatgtctagt      1080
     ttcatcctgg tgaacctgtg gctttgacta ctatagaact ccagagtgtt aggtccacca      1140
     gggcttaatt ccaatcccca gctccacgcc cttaagaccc agctggttct ggagttctag      1200
     gacgttgggt gttttaggat cttattcaag attcctgcgg ggggcccacc ccagctgacc      1260
     gcgtggctct agaatgttcc agatggtcag ggtcccactc ggaaatgtct cacagcccaa      1320
     gtggtttgca gttccagaag gctgggaatt ttacagtacc attccaagtc cttgatcttc      1380
     cttcccagaa acttgacctt gatcatgtcg cttttgaatt tcgaagctcc agagtcagag      1440
     gttaatcact tagttgccta gatgagagaa agatttatct ctatatatgt ggacatacag      1500
     agaaggttta tttatttatt tattatttat ttatttataa atttgcttat gggtggtaag      1560
     ggggaaaaaa gagacctaca cctagaaatc tagctcatat cagggtatcc tcagcctcca      1620
     tgaccccatt tctgacctca gtttccgaag ggggcgggat ggaaaaagag aaaccacgta      1680
     ttttgttatt tttgcttatt ttttatcaga gaaatcatag aaaccagagc ctcctcccca      1740
     ggcccgcact gctcgggttt gcagggagaa cacaccagcc tctggttttt tattttttta      1800
     agaagccatc acctgagcaa ccgagaattc ctctgcgctg aggcccggct tccctctggt      1860
     ggccatttgg gggaattgca aaccgacaag gcagtcggga ttgtaaaatg cacccccatc      1920
     tctcactcca gcctggcttt cagcgccaca gccatggcct gggggccagg ccttaccctg      1980
     aggtgcccga gaggaggcgg gacaagagcc agtaccccca cccctctgcc aatcgggtta      2040
     tggcccccag tgcattcctg ttcagtcccc aaccctactc aataaaaaaa aaatggtttt      2100
     tttgg                                                                  2105
//