spacer

EBI Dbfetch

ID   AK158735; SV 1; linear; mRNA; HTC; MUS; 4871 BP.
XX
AC   AK158735;
XX
DT   06-SEP-2005 (Rel. 85, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 12)
XX
DE   Mus musculus visual cortex cDNA, RIKEN full-length enriched library,
DE   clone:K230308I07 product:brain-specific angiogenesis inhibitor 2, full
DE   insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-4871
RA   Arakawa T., Carninci P., Fukuda S., Hashizume W., Hayashida K., Hori F.,
RA   Iida J., Imamura K., Imotani K., Itoh M., Kanagawa S., Kawai J., Kojima M.,
RA   Konno H., Murata M., Nakamura M., Ninomiya N., Nishiyori H., Nomura K.,
RA   Ohno M., Sakazume N., Sano H., Sasaki D., Shibata K., Shiraki T.,
RA   Tagami M., Tagami Y., Waki K., Watahiki A., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (30-MAR-2004) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; ed2509742d31c9c47dbb32cb7f0cf280.
DR   Ensembl-Gn; ENSMUSG00000028782; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000106015; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000106017; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000121049; mus_musculus.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Tissues were provided by Michela Fagiolini and Takao K. Hensch (
CC   Laboratory for Neuronal Circuit Development Brain Science
CC   Institute RIKEN 2-1 Hirosawa,Wako-shi,Saitama 351-0198 Japan )
CC   whose assistance we gratefully acknowledge.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=K230308I07
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..4871
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="K230308I07"
FT                   /tissue_type="visual cortex"
FT                   /db_xref="taxon:10090"
FT   CDS             57..4577
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="brain-specific angiogenesis inhibitor 2
FT                   (MGD|MGI:2451244 GB|NM_173071, evidence: BLASTN, 99%,
FT                   match=3639)"
FT                   /note="putative"
FT                   /db_xref="GOA:Q8CGM1"
FT                   /db_xref="InterPro:IPR000203"
FT                   /db_xref="InterPro:IPR000832"
FT                   /db_xref="InterPro:IPR000884"
FT                   /db_xref="InterPro:IPR001879"
FT                   /db_xref="InterPro:IPR008077"
FT                   /db_xref="InterPro:IPR017981"
FT                   /db_xref="InterPro:IPR022624"
FT                   /db_xref="MGI:MGI:2451244"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8CGM1"
FT                   /protein_id="BAE34635.1"
FT                   /translation="MTPACPLLLSVILSLRLATAFDPAPSACSALASGVLYGAFSLQDL
FT                   FPTIASGCSWTLENPDPTKYSLYLRFNRQEQVCTHFAPRLLPLDHYLVNFTCLRPGPEE
FT                   ATARAESEVGRPEEEEEEAAAAASGLELCGGSGPFTFLHFDKNFVQLCLSAEPSEAPRL
FT                   LAPAALAFRFVEVLLINNNNSSQFTCGVLCRWSEECGRAAGRACGFAQPGCSCPGEAGA
FT                   NPATTTSPGPPVAHTLSNALVPGGPAPPAEADLHSGSSNDLFTTEMRYGEEPEEEPKVK
FT                   TQWPRSADEPGLYMAQTVHGVWEEWGSWSLCSRSCGRGSRSRMRTCVPPQHGGKACEGP
FT                   ELQTKLCSMAACPVEGQWLEWGPWGPCSSSCANGTQQRSRKCSVAGPAWATCAGALTDT
FT                   RECSNLDCPATDGKWGPWNAWSLCSKTCDTGWQRRFRMCQASGTQGYPCEGTGEEVKPC
FT                   SEKRCPAFHEMCGDEYVMLMTWKRAAAGEIIYNKCPPNASGSASRRCLLSAQGVAYWGL
FT                   PSFARCISHEYRYLYLSLREHLAKGQRMLAGEGMSQVVRSLQELLARRTYYSGDLLFSV
FT                   DILRNVTDTFKRATYVPSADDVQRFFQVVSFMVDSENKDKWDGAQQVSPGSVHLLRVVE
FT                   DFIHLVGDALKAFQSSLIVTDNLVISIQREPISAVSSDITFPMRGRRGMKDWVRHSEDR
FT                   LFLPKEVLSLSSPGKPATPGAATAGSPGRGRGPGTVPPGPGHAHQRLLPADPEESSSYF
FT                   VIGAVLYRTLGLILPPPRPPLAVTSRVMTVTVRPPTQPPAEPLITVELSYIINGTTDPH
FT                   CASWDYSRADTNSGDWNTESCQTLETQAAHTRCQCQHLSTFAVLAQPPKDLTLELAGAP
FT                   SVPLVIGCAVSCMALLTLLAIYAAFWRFIKSERSIILLNFCLSILASNILILVGQSRVL
FT                   SKGVCTMTAAFLHFFFLSSFCWVLTEAWQSYLAVIGRMRTRLVRKRFLCLGWGLPALVV
FT                   AVSVGFTRTKGYGTSSYCWLSLEGGLLYAFVGPAAVIVLVNMLIGIIVFNKLMARDGVS
FT                   DKSKKQRAGSERCPWASLLLPCSACGAVPSPLLSSASARNAMASLWSSCVVLPLLALTW
FT                   MSAVLAMTDRRSVLFQVLFAVFNSAQGFVITAVHCFLRREVQDVVKCQMGVCRADESED
FT                   SPDSCKNGQLQILSDFEKDVDLACQTVLFKEVNTCNPSTITGTLSRLSLDEDEEPKSCL
FT                   VGPEGGLSFSPLPGNILVPMAASPGLGEPPPPQETNPVYMCGEGGLRQLDLTWIRQSEP
FT                   GSEGDYMVLPRRTLSLQPGGGGTAGEEAPRARPEGTPRRAAKTVAHTEGYPSFLSVEHS
FT                   GLGLGPAYGSLQNPYGMTFQPPPPTPSARQVPEPGERSRTMPRTVPGSTMKLGSLERKK
FT                   LRYSDLDFEKVMHTRKRHSELYHELNQKFHTFDRYRSQSSAKEKPSPPGGRPGLSQHRR
FT                   HQSWSTFKSMTLGSLPPKPRERLALHRTAAWEPTEPPDGDFQTEV"
FT   polyA_signal    4853..4858
FT                   /note="putative"
FT   polyA_site      4871
FT                   /note="putative"
XX
SQ   Sequence 4871 BP; 882 A; 1562 C; 1454 G; 973 T; 0 other;
     gactagcgcc ggcccccgct cctgctgctg acggcgccca gggcaaggga cataggatga        60
     ccccagcctg tcccctctta ctgtctgtga ttctgtccct gcgcctggcc acggccttcg       120
     accctgcccc cagtgcctgc tctgccctgg cctcgggcgt gctctacggg gccttctcgc       180
     tgcaggacct ctttcccacc atcgcctcgg gctgctcctg gaccctggag aacccagacc       240
     ccaccaagta ctccctctac ctgcgcttca accggcagga gcaggtttgc acacactttg       300
     ccccgcgcct gctgcccctg gaccactacc tggtcaactt tacctgcctg cggcctggtc       360
     cagaggaagc cacagcccgg gctgagtcgg aggtgggacg gccagaggag gaggaggagg       420
     aggcggcggc agcagcatca gggttggagt tgtgtggtgg ctcaggcccc tttacctttc       480
     tgcacttcga caagaacttt gtgcagctgt gcctgtcggc tgagccctct gaggcccctc       540
     gtctgctagc gcctgctgcc ctggccttcc gttttgtgga ggtcttgctg atcaacaaca       600
     acaactccag ccagttcacc tgtggtgtgc tctgccgctg gagtgaggag tgtggccggg       660
     ctgcaggcag ggcttgtggc tttgcacagc cagggtgtag ttgtcctggg gaggcagggg       720
     ccaaccccgc caccaccaca tctccggggc ctccggttgc ccacaccctg tccaatgccc       780
     tggtgcccgg gggcccagcc cctcctgctg aggccgactt gcactcgggg agcagcaatg       840
     acctgttcac caccgagatg agatatggtg aggagccgga agaggaaccg aaggtgaaaa       900
     cccagtggcc aaggtctgca gatgagcctg ggctatacat ggcgcagaca gtgcacggcg       960
     tgtgggagga gtgggggtcc tggagcctgt gctcccgcag ctgcgggcgg gggtctcgga      1020
     gccggatgcg gacctgcgtg cccccccagc acggcggcaa ggcctgcgag ggtcccgagc      1080
     tgcagactaa actctgcagt atggccgcct gcccggtgga aggccagtgg ctagaatggg      1140
     gtccctgggg cccatgctca tcatcttgtg ccaatgggac ccagcagcgc agccggaaat      1200
     gcagtgtggc gggtccagcc tgggccacgt gcgcaggtgc cctcacggat acccgtgagt      1260
     gcagcaatct cgattgcccg gccactgacg gcaagtgggg gccgtggaac gcgtggagcc      1320
     tgtgctccaa gacgtgtgac acgggctggc aacgccgctt ccgcatgtgc caggcttctg      1380
     gcacacaggg ctacccttgc gagggcacag gagaggaggt gaaaccctgc agtgagaaga      1440
     ggtgtccagc cttccatgag atgtgcgggg atgagtacgt gatgttgatg acatggaaga      1500
     gggcggcagc tggcgagatc atttacaaca agtgtccccc taatgcctcg ggttctgcta      1560
     gccgccgctg tctcctcagt gcccagggcg tagcatactg gggactgccc agctttgctc      1620
     gttgcatatc ccatgaatac cgctacctgt acctgtcact tcgggaacac ctggctaagg      1680
     gccagcgcat gctggcaggt gagggcatgt cacaggtggt gcggagcctg caggagctac      1740
     tggcacggcg cacttactac agcggggacc tgctcttctc tgtggacatc ctaaggaacg      1800
     tcactgacac cttcaagagg gccacctatg tcccttccgc cgatgacgtg cagcgtttct      1860
     tccaggtggt gagcttcatg gtggattcag aaaacaagga caaatgggat ggtgctcagc      1920
     aggtgtcacc gggctctgtg cacctgctgc gtgttgtgga agatttcatt cacctcgtgg      1980
     gcgacgctct caaggccttc cagagctctc tcattgtcac ggacaatctg gtgatcagca      2040
     ttcagagaga gcctatctcc gccgtgtcca gtgacatcac gtttcccatg cggggccgca      2100
     ggggcatgaa ggactgggtg cgacactcag aggatcgtct ctttctaccc aaggaggtgc      2160
     tcagcctgtc ctccccagga aagccagcca cacctggggc agccacagca ggcagcccgg      2220
     gcagggggag gggcccagga acggtgcccc ctggcccagg ccacgcccac cagcgccttc      2280
     tcccagctga ccccgaagag tcctcctcct actttgtgat cggtgctgtg ctctaccgca      2340
     cccttggcct catcctgccg ccccccaggc ctccacttgc tgtcacctcc cgggtgatga      2400
     cagtgactgt gcgtcccccc acccagcctc cagctgagcc cctcattaca gtggaactct      2460
     cgtacatcat caatggcacc accgatcccc actgtgccag ctgggactac tccagagcag      2520
     ataccaactc gggggactgg aacactgaga gctgccagac cttggagacc caggcggctc      2580
     acacccgctg ccagtgccag cacctgtcca cctttgccgt cctggcccag ccacccaagg      2640
     acctgaccct ggagctggca ggtgctccct ctgtccccct ggtgatcggc tgtgcagtgt      2700
     cctgcatggc tctgctcacc ctgctggcca tctatgcagc cttctggagg tttataaaat      2760
     cagaacgctc catcatcttg ctgaacttct gcctgtccat cctggcttcc aacattctga      2820
     tcctggtggg ccagtcccgg gtgctgagca agggcgtatg caccatgacg gctgccttcc      2880
     tacacttctt ctttctgtcc tccttttgct gggtgcttac agaggcctgg caatcctatc      2940
     tggctgtcat cgggcggatg cgcacccgcc tggttcgcaa gcgcttcctc tgcctgggct      3000
     ggggtctacc tgccctggtg gtggctgtgt ctgttggctt tactcgcacc aaaggatatg      3060
     gtacatccag ctactgctgg ctgtccctag agggcggcct gctctatgcc ttcgtgggtc      3120
     cagcagcagt cattgtcctg gtgaacatgc tcatcgggat tatcgtcttc aacaagctca      3180
     tggctcgcga tggcgtctca gacaaatcta agaagcagag ggctgggtcg gagcggtgcc      3240
     cctgggccag cctgctcctt ccctgctcag cgtgtggagc ggtccccagc cccctgctca      3300
     gctcagcctc ggccaggaat gccatggctt cactctggag ttcctgcgtg gtactgcctc      3360
     tcctggcgct tacctggatg tctgccgtcc tggccatgac agatcgccgc tccgtcctct      3420
     tccaggtact ctttgccgtt ttcaactctg cacaaggctt tgtcatcacc gctgtgcact      3480
     gcttcctgcg ccgagaggtc caggatgtgg taaagtgtca gatgggtgtg tgtcgggctg      3540
     atgagagtga agactcccca gactcgtgca agaacgggca gctgcagatc ctgtcagact      3600
     ttgaaaagga cgtggatctg gcttgtcaga cagttctgtt caaggaggtc aacacctgca      3660
     acccgtccac cattaccggc actctgtccc gcctgtctct ggatgaggat gaggagccca      3720
     agtcctgtct cgtgggtcct gagggtggcc tcagcttctc accactgcct gggaacatcc      3780
     tggtacccat ggcagcctca ccaggtctag gggagccacc accaccccag gagaccaacc      3840
     ctgtgtacat gtgtggggag ggtggcctgc ggcagttgga ccttacatgg atacggcaga      3900
     gtgaaccagg ctctgagggg gactacatgg ttctgccccg gcggactttg agcctgcagc      3960
     ctggtggtgg gggtacagcg ggtgaggagg ccccaagggc ccggcctgag gggacccccc      4020
     ggcgggctgc caaaacggta gcccacactg aaggctaccc cagcttcctg tctgtggagc      4080
     actcgggtct agggctgggc cctgcctatg ggtctctcca gaacccgtat ggaatgacct      4140
     tccaaccacc accaccaaca cccagcgccc gccaagtacc agagccagga gaacgtagcc      4200
     ggaccatgcc ccgtacagtg cctggttcca ccatgaagct gggctccctt gagcgaaaga      4260
     agcttcggta ttcggacttg gactttgaga aggtgatgca cactcggaaa cggcactcgg      4320
     aactctacca cgaactcaac cagaagttcc acactttcga ccgctaccgt agccagtcct      4380
     cagccaagga gaaacccagc ccccccgggg gacgccctgg cttgtcccag cacaggaggc      4440
     atcaaagctg gagcaccttc aaatctatga cactgggctc actgcccccc aagccccgag      4500
     aacggctggc cctgcaccgg acagcagcct gggagcccac agaaccgcca gacggcgact      4560
     tccagacaga ggtgtgagtg ccacgccgga ctgcccactg cacagaaata tatatctatt      4620
     ttcacactcc actttggaac taccaggagc cagcgcccct ccccctcccg aggctgggca      4680
     ggaggcgcag aggactcagc ctggctgggg gcagccagac tggcagggcc tggggggcca      4740
     gggcccctcc ttgttctcag aggtccctta gccacccact ggagcctcat ctttgccccg      4800
     gcctgtctgt ccctgtcctg ggctggggag gggggaggga aactttgttg ggaataaact      4860
     tcactctgtg g                                                           4871
//


spacer
spacer